SecReT6
Protein ID: 213156448
SecReT6 ID311
T6SS typei4b
Gene symbol-
Locus tagAB57_1492
StrainAcinetobacter baumannii AB0057
Repliconchromosome [GenBank: NC_011586] [Browse all T6SS(s) in this replicon]
Location [Strand]1576911..1578275 [+]
Producttype VI secretion protein, family
NoteTssK
UniProt IDB7I201
KEGG IDabn:AB57_1492
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.50E-126, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|213156448|ref|YP_002318868.1| type VI secretion protein, family [Acinetobacter baumannii AB0057]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSAMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIEPH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|213155370|ref|NC_011586.1|:1576911-1578275 Acinetobacter baumannii AB0057 chromosome, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGCGAAGGTCTATTTTTAAGACCTCAACATTTCCAGATTCAAG
ATACCTATCATGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTGCCATTTTCCTATGGCGTTCAAAA
ACTTAGTTTTGATGAAGCACAGCTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAA
GACGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAAAATTTAATCGATCA
AAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCACGATCTGTTCACAAACGCGACA
GAAGCTGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGTAATCCTGATC
ATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTCGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTTGATGCATCTGAGACCTTAGTTTCAAATTTAAAAAGA
ACCTTGAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCT
GAGCCATTTCTTGCAATATCCGCAAATTCATCCGGAACGCTTATTCTTTGAATTGCTACGTTTGGCAGGT
TCATTATTAACTTTCTCGACAGCTTATGAAGTTGATCAGTTGCCTGCATATAAACATCATAATTTGCAAG
AGAGCTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGATTACTCGAGAT
ACCAGACTTTATATTGCTGTATCAAGTAGCGCGATGCAGACCCACGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACA
TCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACCGCAT
CATGAACTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA