SecReT6
Protein ID: 215483902
SecReT6 ID312
T6SS typei4b
Gene symbol-
Locus tagABBFA_002225
StrainAcinetobacter baumannii AB307-0294
Repliconchromosome [GenBank: NC_011595] [Browse all T6SS(s) in this replicon]
Location [Strand]2367193..2367999 [-]
Producthypothetical protein
NoteTssL
UniProt IDB7H4H9
KEGG IDabb:ABBFA_002225
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.90E-53, Aligned region: 34..239
Protein Sequence: 268 a.a.     [Download]
>gi|215483902|ref|YP_002326127.1| hypothetical protein ABBFA_002225 [Acinetobacter baumannii AB307-0294]
MSQSTGAPSLFDDGQIGTGGNNNSQSQVKLQAINLIDLLHDGFYLIFLIRNQYVPADPQRFREKILDLLN
RFEQQAKKLQFSADDIHDAKYAFCALIDETIVTQQDPSYFNLQNSWLISPLQLSLFGSQLAGYQFFEILE
QLRSRGKERLAALEVFHYCLLLGFQGKYRIESIESLNHLVARVGDEIDYLKGKKVAFSPFSAIPDQIRNI
IHRELPFFWILIFLLIFALLTFAGLRFMLNNQNDKALSNYQNVISAPQEQAHITIYLP
 
Nucleotide Sequence: 807 bp     [Download]
>gi|215481761|ref|NC_011595.1|:c2367999-2367193 Acinetobacter baumannii AB307-0294, complete genome
ATGTCACAATCTACAGGTGCTCCTTCTTTATTTGACGATGGGCAAATTGGGACAGGGGGGAATAATAATA
GCCAGTCCCAAGTAAAGTTACAGGCAATTAATCTGATTGATTTATTGCATGATGGTTTTTACTTAATCTT
TTTAATTCGAAATCAGTATGTGCCAGCTGATCCACAGCGCTTTCGTGAAAAAATTCTAGATTTGCTTAAT
CGATTTGAGCAACAAGCGAAAAAGTTACAATTTTCAGCTGATGATATTCATGATGCTAAATATGCGTTTT
GTGCGCTAATTGATGAAACGATCGTAACCCAGCAAGACCCAAGCTATTTTAATTTACAAAATTCTTGGTT
AATTAGCCCATTACAGTTAAGTCTGTTTGGTTCTCAGTTAGCGGGTTATCAATTCTTCGAAATTTTAGAG
CAACTACGTAGTCGTGGAAAAGAGCGATTAGCTGCTCTTGAAGTCTTCCATTACTGCTTATTATTAGGTT
TTCAGGGTAAATACCGAATTGAGTCAATTGAAAGCCTTAACCATTTGGTGGCACGAGTAGGCGATGAAAT
TGATTATCTGAAAGGGAAAAAAGTGGCTTTTTCGCCATTCTCGGCAATTCCTGATCAGATACGAAATATT
ATCCATCGTGAGCTACCTTTTTTCTGGATTTTGATTTTCTTATTGATTTTTGCATTACTTACCTTTGCAG
GTTTAAGATTTATGCTTAACAATCAAAATGATAAAGCATTATCTAATTATCAAAATGTGATTTCTGCCCC
ACAAGAGCAGGCACATATTACTATTTACTTACCTTGA