SecReT6
Protein ID: 215483911
SecReT6 ID312
T6SS typei4b
Gene symbol-
Locus tagABBFA_002234
StrainAcinetobacter baumannii AB307-0294
Repliconchromosome [GenBank: NC_011595] [Browse all T6SS(s) in this replicon]
Location [Strand]2380727..2381725 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7H4I8
KEGG IDabb:ABBFA_002234
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.60E-63, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|215483911|ref|YP_002326136.1| hypothetical protein ABBFA_002234 [Acinetobacter baumannii AB307-0294]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GGQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDESEIQPVRLTQGQESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|215481761|ref|NC_011595.1|:c2381725-2380727 Acinetobacter baumannii AB307-0294, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAATCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTATCATGGTCTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAATTTTCCAGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAGCGTGTTCATTTAACAAACCTGATCGTTGGTCTTACCGGTATACAGGGTGCATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGAAAGAGTTTTTAAGCTTGTTTAATCA
TAAGTTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTCCATGCATTGAATGGCTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGGTCAGCTAACCACTTTAGGTGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCGTCAGCAATATTTAAAATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGTCTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTG
GCCTAGGGCAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATAGGAGAGCAAATATGA