SecReT6
Protein ID: 217978498
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2353
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2560345..2561829 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDB8EIG4
KEGG IDmsl:Msil_2353
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-56, Aligned region: 102..307
OmpA [PF00691], Evalue: 6.50E-16, Aligned region: 385..484
Protein Sequence: 494 a.a.     [Download]
>gi|217978498|ref|YP_002362645.1| DotU family type IV / VI secretion system protein [Methylocella silvestris BL2]
MNEKDPPDSLGRRDNRTIIVPNPGGRRPEAARPSPAYAPPPSGAPYVPAQPGAAPVWPSHPSHGAEASPG
DEWIKGRAAAAQTPDRIVRDIPIDDLLVPNENPLLRAAGPLLLLLGRLRVAQLQASPASLMGQVAEAVAF
FDKEIRATGVPPQQAETAKYILCATADDIVQNIPTEDRHVWTQYSMLSRFFGERIGGVRFFSELDKAKTD
PLNNYDLLELIYDCLALGFQGVHRSSATGAVSLQQIQRDLYELLRRVRPRVDRELSPHWRGQSLPRGVMR
ARIPFWAIASLAALCLFGLFITLRMLLTGAADVAAADLNGLIGRGDLKLVRHNFAPPPKPPEPPPGKLTQ
LQRIRLALAPEIAAKKVDATQTATKIRIIVGDLVLFPSGQANVKPQFEPIAKRIAQTLEKEPGAITIVGH
TDNVKLQATSPFDSNWTLSMARAKAVAAVLKPGLSEPARIEVDGKADEQPIAPNDTPAGRAQNRRVEIML
ARSD
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|217976200|ref|NC_011666.1|:c2561829-2560345 Methylocella silvestris BL2 chromosome, complete genome
ATGAACGAGAAGGACCCGCCGGACAGCCTCGGGCGGCGCGACAATCGTACGATCATCGTGCCGAACCCCG
GCGGGCGAAGGCCCGAGGCGGCGCGCCCTTCGCCTGCCTATGCACCGCCTCCTTCGGGCGCGCCCTATGT
CCCGGCGCAGCCGGGCGCGGCGCCTGTTTGGCCGTCACACCCCTCTCATGGCGCAGAGGCCTCCCCCGGC
GACGAATGGATCAAGGGACGCGCAGCGGCGGCGCAAACGCCCGATCGGATCGTGCGCGATATTCCGATCG
ACGATCTTCTTGTCCCCAATGAAAATCCGCTGCTGCGCGCGGCGGGGCCATTGCTGCTGCTGCTTGGTCG
TCTGCGCGTCGCGCAGCTGCAGGCGTCGCCCGCGAGCCTGATGGGGCAGGTGGCGGAGGCCGTCGCTTTT
TTCGACAAGGAGATTCGCGCGACGGGCGTCCCGCCGCAGCAGGCGGAAACCGCGAAATATATTCTCTGCG
CCACCGCCGACGACATCGTCCAGAACATCCCGACCGAGGATCGCCACGTCTGGACGCAATATTCGATGCT
GAGCCGCTTCTTCGGCGAACGCATCGGCGGCGTTCGCTTCTTCTCCGAGCTCGATAAAGCGAAGACCGAT
CCGCTCAATAATTACGATCTGCTCGAACTCATCTATGATTGCCTCGCGCTCGGCTTCCAGGGCGTGCACC
GCAGTTCGGCGACCGGCGCCGTCAGCCTGCAGCAAATCCAGCGCGATCTTTACGAGCTCTTGCGCCGGGT
CCGTCCGCGCGTCGACCGGGAGCTGTCGCCGCATTGGCGCGGCCAGAGCCTGCCGCGCGGCGTCATGCGC
GCACGCATTCCCTTCTGGGCGATCGCCAGCCTCGCCGCGCTCTGCCTGTTCGGCCTCTTCATTACCTTGC
GCATGCTGCTAACGGGCGCCGCCGATGTTGCAGCAGCGGACCTCAACGGCCTGATCGGCCGCGGCGACCT
GAAGCTGGTGAGGCATAATTTTGCCCCGCCGCCGAAGCCGCCCGAGCCGCCGCCCGGCAAACTGACCCAG
CTCCAGCGCATCAGGCTCGCGCTCGCTCCCGAAATCGCAGCGAAGAAGGTCGACGCCACCCAGACCGCGA
CGAAGATCAGGATCATTGTCGGCGATCTCGTGCTGTTTCCGTCAGGGCAGGCCAATGTGAAGCCGCAGTT
CGAGCCGATCGCCAAGCGCATCGCGCAGACTTTGGAAAAGGAGCCGGGCGCGATCACGATCGTCGGCCAT
ACCGACAATGTGAAGCTGCAGGCGACGTCGCCCTTCGACTCGAACTGGACTTTGTCGATGGCGCGCGCCA
AGGCGGTCGCCGCCGTGCTGAAGCCGGGCCTTAGCGAACCGGCCCGCATCGAAGTCGACGGAAAGGCGGA
CGAGCAGCCGATCGCGCCGAACGATACGCCGGCGGGGCGGGCGCAGAACCGCCGCGTCGAAATCATGCTC
GCCCGATCGGACTGA