SecReT6
Protein ID: 217978499
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2354
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2561846..2563186 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB8EIG5
KEGG IDmsl:Msil_2354
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-127, Aligned region: 20..441
Protein Sequence: 446 a.a.     [Download]
>gi|217978499|ref|YP_002362646.1| type VI secretion protein [Methylocella silvestris BL2]
MMSWYSKVLWSEGLFLRPHHLQQADRYLEHLIEARTRSATPYPWGFSHLEIDRDLAQQSKFAVRRAAGVM
PDGTPFDIPNDSPAPPPLEVPDGAAQQLLWLSMPTASSNTREVDSADSSSASRFVIGAETFIDSTSSLRI
EEEIDVAYPRLAFDLRKTAKPGFQGLPIARIVEVRDKSIVFDEKFAPTVLVCSAHPTVEGWLDRVIGWID
AKLGELARYAADPTAGGGLQSVDYLVLQVLNRHITVMQHLRGSRYVHPERLYVELIRLAGELATFATTER
RARLYPLYDHDNLEASFAPVLRDLQDFLSARLGRRAIRLDIIARAENAFISPIRDRSLFRNASLVLEVAA
RRPLTEIQSSFPHLFKVGPGSKMNEIVHAHLPGVPLVHLPTPPPQIRAITDHVYFYLDRTSPLWPEFSTA
SSIGMHFSGDWPELSLELWAVLEDRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|217976200|ref|NC_011666.1|:c2563186-2561846 Methylocella silvestris BL2 chromosome, complete genome
ATGATGTCCTGGTACAGTAAAGTCCTTTGGTCGGAAGGACTTTTCCTTCGCCCCCACCACCTTCAGCAGG
CCGACCGTTACCTCGAACATCTGATCGAGGCGCGAACGCGCAGCGCCACCCCCTATCCCTGGGGTTTTTC
GCATCTTGAGATCGACCGCGACCTTGCGCAGCAGAGCAAATTCGCGGTGCGCCGCGCGGCGGGGGTGATG
CCGGACGGAACGCCCTTCGACATTCCCAACGACAGCCCGGCGCCGCCGCCGCTCGAAGTGCCGGATGGCG
CGGCGCAACAACTGCTCTGGCTGTCGATGCCGACCGCTTCATCAAATACGCGCGAGGTCGATTCGGCCGA
TTCGTCGAGCGCCAGCCGCTTCGTCATCGGCGCCGAGACCTTTATCGATTCGACCTCCTCGCTGCGCATC
GAGGAGGAGATCGACGTCGCCTATCCGCGCCTCGCCTTCGATCTGCGCAAGACGGCCAAGCCCGGCTTTC
AGGGGCTCCCCATCGCCCGCATCGTCGAGGTGCGCGATAAATCGATCGTTTTCGACGAGAAATTCGCCCC
GACCGTTCTGGTCTGCTCGGCTCATCCGACCGTCGAGGGCTGGCTCGACCGGGTGATCGGCTGGATCGAC
GCAAAGCTCGGCGAACTCGCCCGCTATGCTGCGGACCCGACCGCGGGCGGCGGACTGCAAAGCGTCGATT
ATCTGGTGCTGCAAGTCCTGAACCGCCACATCACGGTGATGCAGCATCTGCGCGGATCGCGCTATGTCCA
TCCCGAACGGCTCTATGTCGAGCTGATCCGGCTCGCCGGGGAACTTGCGACCTTCGCCACCACCGAGCGC
CGCGCGAGGCTCTATCCGCTCTACGACCATGACAATCTGGAGGCGAGCTTCGCGCCCGTCCTGCGCGATC
TGCAGGATTTCCTTTCGGCGCGGCTGGGGCGGCGGGCGATCCGCCTCGACATCATCGCGAGGGCGGAGAA
CGCCTTCATCTCGCCGATCCGCGACCGCAGCCTGTTCCGCAACGCAAGCCTCGTCCTCGAAGTGGCGGCG
CGCCGGCCGCTGACCGAGATTCAGTCGAGCTTCCCGCATCTGTTCAAGGTCGGCCCCGGCTCCAAGATGA
ACGAAATCGTGCACGCCCATCTGCCCGGCGTGCCGCTGGTGCATCTGCCGACGCCGCCGCCGCAGATCCG
CGCCATCACCGACCATGTCTATTTCTATCTCGACCGCACCTCGCCGCTATGGCCGGAATTCTCGACGGCG
AGTTCGATCGGCATGCATTTCTCCGGCGATTGGCCCGAGCTCAGCCTCGAGCTCTGGGCCGTCCTGGAAG
ACCGGTCATGA