SecReT6
Protein ID: 217978500
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2355
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2563246..2564607 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDB8EIG6
KEGG IDmsl:Msil_2355
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.60E-18, Aligned region: 30..96
Protein Sequence: 453 a.a.     [Download]
>gi|217978500|ref|YP_002362647.1| FHA domain-containing protein [Methylocella silvestris BL2]
MALKLAIENMTNLPDGGPVSITVTGKRGVDIGRDAHLDWTLPDPSRFISGKHCEIRFEGGAYVLTDVSSN
GTFLNEQPHRMREPHRLRNGDRLLIGQYVVAVSLDGTEEREESAAPALGRRPLDADLWESGEPVPEPIDP
RVLKPVPERAKGPDFLDWAMDVFDPLSPTPAKPNAASRFEDASWLPPPPTAPVAPPPPEAPAPRRPVWSA
DDAEPPARVSAPPAPPVMPPPAPAEAPPASPPPPAPIAPAAPPVRAENTDAAGARFVRRFAEAAGLPPEA
IAKQDADELAAELGALMKLVTEDLRQLLGARLEVKRMARASQTTIRAADNNPLKFSPTTEDALRQMFGAP
TRSYLPAGAALKQGFEDLKRHQLQSASAMQGAVKMLTEDLDPDRIEQEIAPDSGLSGLFSARKGKLWDAY
VARFKAKTHRHGDGLIGAFMLYFSQCYDQTHKQ
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|217976200|ref|NC_011666.1|:c2564607-2563246 Methylocella silvestris BL2 chromosome, complete genome
ATGGCGCTGAAACTCGCAATCGAAAATATGACCAATCTGCCCGATGGCGGCCCGGTCAGCATCACCGTCA
CCGGCAAGCGCGGCGTCGATATCGGCCGCGACGCGCATCTTGACTGGACGCTGCCGGACCCGAGCCGCTT
CATCTCGGGGAAACATTGCGAGATCCGCTTCGAGGGCGGCGCCTATGTGCTGACCGACGTCTCCTCGAAC
GGCACCTTTCTCAACGAGCAGCCGCATCGCATGCGCGAGCCGCACCGACTGCGCAACGGCGACCGTCTGC
TGATCGGGCAATATGTCGTTGCGGTTTCGCTTGACGGGACGGAGGAGCGCGAGGAGTCGGCGGCGCCGGC
GCTAGGGCGCCGCCCGCTCGACGCCGATTTGTGGGAATCGGGCGAACCGGTCCCCGAGCCGATCGATCCG
CGCGTGCTGAAGCCTGTTCCGGAGCGGGCGAAGGGGCCGGATTTCCTGGACTGGGCGATGGATGTCTTCG
ATCCGTTGAGCCCCACGCCGGCAAAGCCCAATGCGGCCAGCCGGTTCGAGGACGCAAGCTGGCTGCCGCC
GCCGCCAACGGCGCCGGTCGCGCCGCCCCCGCCGGAAGCGCCCGCGCCGCGCCGGCCGGTCTGGTCCGCG
GACGACGCCGAGCCGCCCGCGCGAGTCTCCGCTCCGCCGGCCCCGCCCGTGATGCCGCCCCCGGCTCCGG
CCGAAGCGCCGCCGGCTTCTCCCCCTCCGCCCGCGCCGATCGCGCCCGCGGCGCCGCCGGTTCGCGCGGA
GAACACCGACGCGGCGGGGGCGCGCTTCGTGCGGCGCTTCGCCGAGGCCGCCGGCCTGCCGCCGGAGGCG
ATCGCCAAGCAGGACGCCGATGAATTGGCGGCCGAGCTCGGCGCGCTGATGAAGCTCGTCACTGAGGATT
TGCGTCAGCTCCTCGGCGCAAGGCTGGAGGTCAAGCGCATGGCGCGGGCGAGCCAGACGACGATCCGCGC
CGCCGACAACAACCCCCTGAAATTTTCGCCGACGACCGAGGACGCGCTGCGGCAGATGTTCGGGGCGCCG
ACGCGCAGCTATCTGCCCGCGGGCGCCGCGCTGAAACAGGGCTTTGAGGATCTCAAACGCCACCAGCTCC
AGTCGGCCTCGGCCATGCAGGGCGCCGTGAAAATGCTCACCGAAGATCTCGATCCGGATCGGATCGAGCA
GGAGATCGCGCCGGACAGCGGCCTCTCCGGGCTTTTCTCGGCGCGCAAGGGCAAGCTCTGGGACGCCTAT
GTGGCGCGCTTTAAAGCCAAGACACATCGCCATGGCGATGGCCTGATCGGCGCCTTCATGCTCTACTTCT
CGCAATGCTATGATCAAACGCACAAACAATAG