SecReT6
Protein ID: 217978502
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2357
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2565212..2567071 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB8EIG8
KEGG IDmsl:Msil_2357
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-83, Aligned region: 32..332
Phage_base_V [PF04717], Evalue: 7.30E-22, Aligned region: 372..460
DUF2345 [PF10106], Evalue: 5.00E-05, Aligned region: 535..595
Protein Sequence: 619 a.a.     [Download]
>gi|217978502|ref|YP_002362649.1| ImpA family type VI secretion-associated protein [Methylocella silvestris BL2]
MTSELTQDKRVASLETPLGKDKLVCLRFDGAEGLSELFEYRVEALSTEANVDFDKAIGNNCSVTFKSYSD
PDRVFNGVLVEAQALGAQAGLNLYRLTLKPWLWLLSRTSDCRIFENQTAVDIIKKVFSDRGFSDYRVATT
GKFPELEYCVQYRETDLAFVSRLMEQHGIYYFFEHQKDKHTLVLADAKSSHKPVPGHAETPFIGDERQTR
REREHISKWTPERRFRSGKFELNDYDYLQPNADLKSDAEGQASYTKSKMEIYDYPGKFKKKNDGETYAKV
RLQAEQAMDKRRYADGDSVSLLPGGLTTLKDHPEGGENKEYLVLRALHSYSSQAYRSGGSQGADLYSGRY
ELLPSDVNYRAPLATPRPIVYGPQTAKVVGKDGEEIDVDEHGRILVRFYWDRKNKQSCRVRVAQVWAGKG
WGGQAIPRIGQEVVVEFLEGDPDRPLVTGAVYNGDNKYPYEMPANKTQSGLKSDSSKGHGGYNEFMFEDK
KGSEKIRMHGERDHEVVIRRAETKEVGEIFSSRSDPSRDTTLKNGSDNLSIQNGNQTVDIKGKQDVSVLE
TISIEAIQKITLTVGASTITMEPAQITINSPMITVQSSLATKISGGMAINLDAAIIKIN
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|217976200|ref|NC_011666.1|:c2567071-2565212 Methylocella silvestris BL2 chromosome, complete genome
ATGACTTCCGAACTGACCCAAGACAAACGCGTCGCCTCGCTTGAGACGCCTCTCGGCAAGGACAAGCTCG
TCTGCCTGCGCTTCGACGGCGCCGAAGGCTTGAGCGAATTGTTCGAATATCGCGTCGAGGCGCTGAGCAC
CGAGGCGAATGTCGATTTCGACAAGGCGATCGGCAATAATTGCTCGGTCACGTTCAAATCCTATTCCGAT
CCCGATCGCGTCTTCAACGGCGTCCTCGTCGAGGCGCAGGCTCTCGGCGCGCAAGCTGGCCTCAATCTCT
ACAGGCTGACGCTAAAGCCCTGGCTGTGGCTGTTGTCGCGCACGAGCGACTGCCGCATCTTCGAGAATCA
GACGGCGGTCGACATCATCAAGAAGGTGTTTTCCGACCGCGGCTTCTCCGACTACAGGGTTGCGACGACG
GGCAAGTTTCCGGAGCTCGAATATTGCGTCCAGTATCGCGAGACCGACCTCGCCTTCGTCTCAAGGTTGA
TGGAGCAGCACGGAATCTACTATTTCTTCGAGCATCAGAAGGACAAGCACACGCTGGTGCTGGCCGACGC
CAAATCGTCGCACAAGCCGGTTCCCGGCCACGCCGAGACGCCCTTCATCGGCGATGAGCGGCAGACGCGG
CGCGAGCGCGAGCATATTTCAAAGTGGACGCCCGAGCGCCGCTTCCGCAGCGGCAAGTTTGAGCTCAACG
ATTATGATTATCTGCAGCCGAACGCCGATCTGAAAAGCGACGCCGAAGGGCAAGCGTCCTACACCAAGTC
GAAGATGGAGATCTACGACTATCCCGGCAAATTCAAAAAGAAGAATGACGGCGAGACCTATGCGAAGGTC
AGGCTGCAGGCGGAGCAGGCGATGGACAAGCGCCGCTACGCCGACGGCGATTCGGTCAGCCTCTTGCCAG
GCGGCCTGACGACGCTGAAGGATCATCCGGAAGGCGGCGAGAACAAGGAATATCTCGTTCTGCGCGCGCT
CCATTCTTATTCGTCGCAAGCCTACAGGTCCGGCGGTTCGCAGGGAGCGGACCTTTATTCCGGACGTTAC
GAGCTGTTGCCGAGCGACGTCAATTACCGCGCGCCTTTGGCGACGCCGCGGCCGATCGTCTACGGGCCGC
AGACGGCCAAGGTGGTTGGCAAGGACGGCGAGGAAATCGACGTCGACGAGCACGGCCGCATTCTTGTGCG
CTTCTACTGGGACCGCAAGAACAAGCAGTCGTGCCGCGTCCGCGTCGCGCAGGTGTGGGCCGGCAAGGGC
TGGGGCGGCCAGGCGATTCCGCGCATCGGCCAGGAAGTCGTCGTCGAGTTTCTCGAAGGCGATCCCGATC
GCCCGCTCGTCACCGGCGCCGTCTACAATGGCGACAACAAATACCCGTATGAAATGCCCGCCAACAAGAC
GCAATCCGGGCTCAAGTCGGATTCCTCGAAAGGCCATGGCGGCTACAATGAATTTATGTTCGAGGACAAG
AAGGGCTCGGAAAAAATCCGGATGCATGGCGAGCGCGATCATGAGGTCGTCATCCGCCGCGCCGAGACGA
AAGAGGTCGGCGAGATCTTTTCAAGCCGCAGCGATCCCTCGCGCGACACCACACTGAAGAACGGCAGCGA
CAATCTGTCGATCCAGAACGGCAACCAAACGGTCGACATCAAGGGCAAGCAGGACGTCAGCGTGCTCGAG
ACGATCAGCATCGAGGCGATCCAGAAGATCACGCTGACGGTCGGCGCCAGCACGATCACCATGGAGCCGG
CGCAGATCACGATCAATTCGCCGATGATCACCGTGCAGTCGTCTCTGGCGACCAAGATTTCCGGCGGCAT
GGCGATCAATCTCGACGCCGCGATCATCAAGATCAATTGA