SecReT6
Protein ID: 217978503
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2358
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2567293..2568618 [+]
Producthypothetical protein
NoteTssA
UniProt IDB8EIG9
KEGG IDmsl:Msil_2358
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.50E-09, Aligned region: 78..126
ImpA-rel_N [PF06812], Evalue: 9.50E-09, Aligned region: 208..221
Protein Sequence: 441 a.a.     [Download]
>gi|217978503|ref|YP_002362650.1| hypothetical protein Msil_2358 [Methylocella silvestris BL2]
MTIASPDDSPLSFEALTGAISEASPCGPDLDLEGDATYMNFMAAGEGVLPATFYSGHDGRPFDRTQIDFP
AQYATIAALNALSRDLRLIALLAKFRILDKDFSGFVAATAALAELLETRWDEVHPRGEDGDFTLRMVAVQ
SLDDMAPVILPLHYAPLFEHKRLGTVTYRTHLLASGEAAPRGEEERPDGGLVRRAFEEVDLDILIGRRDE
LRRLTEALTRIKSAFVTHVGAADAVAFPKLAPLAEAMRALIQSFVALRDPSAAEPLPIAEDSETAADGAP
AVAGEIASFADAAAALNAVSAYYMRREPSNPALLLVRQAEQLIGKSFLDVLRVLVPGHVEEAALQIGRAQ
FFNLPIERLSEFASVEEPASDQETDKVFTVTTRDNALQLLSKISAFYHQAEPSSPISYLIERARAVTGRD
FLGLLKDMLPPDSLKSLDSPK
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|217976200|ref|NC_011666.1|:2567293-2568618 Methylocella silvestris BL2 chromosome, complete genome
TTGACCATCGCTTCGCCAGATGATTCGCCGCTCTCCTTCGAGGCCCTGACGGGGGCCATTTCCGAAGCCT
CCCCTTGCGGCCCGGATCTCGATCTCGAAGGCGACGCCACCTATATGAATTTCATGGCTGCTGGCGAAGG
CGTGTTGCCGGCGACCTTCTATTCCGGCCATGACGGGCGCCCGTTCGACCGCACCCAGATCGACTTTCCG
GCGCAATATGCGACGATCGCCGCGCTCAACGCTTTGAGCCGCGATCTGCGCCTCATCGCGCTGCTGGCCA
AATTCCGCATCCTCGACAAGGATTTTTCCGGCTTCGTCGCGGCGACGGCGGCGCTCGCCGAACTGCTCGA
GACGCGCTGGGACGAGGTCCATCCTCGCGGGGAGGACGGCGATTTCACCTTGCGCATGGTCGCGGTTCAG
TCGCTCGACGACATGGCGCCCGTCATCCTGCCGCTGCATTATGCGCCGCTGTTCGAGCACAAGCGCCTCG
GCACGGTGACCTATCGCACGCATCTGCTCGCATCCGGCGAGGCCGCGCCCCGCGGCGAGGAAGAGCGGCC
CGACGGCGGCCTCGTCCGCCGCGCCTTCGAGGAGGTCGATCTCGACATTCTCATCGGGCGCCGCGATGAA
TTGCGCAGGCTGACCGAGGCGCTCACGCGCATCAAATCGGCTTTCGTCACGCATGTCGGCGCCGCCGATG
CGGTCGCCTTTCCAAAGCTCGCGCCGCTCGCCGAGGCAATGCGCGCGCTGATCCAGTCCTTCGTCGCGCT
GCGCGACCCCTCCGCGGCCGAGCCTCTTCCGATCGCCGAGGACTCCGAGACGGCTGCGGACGGCGCCCCC
GCCGTCGCGGGAGAGATCGCGAGCTTTGCCGACGCCGCCGCCGCGCTGAACGCGGTCAGCGCCTATTATA
TGCGCCGCGAGCCGTCCAATCCGGCGCTGCTCCTCGTGCGCCAGGCCGAGCAGCTGATCGGCAAATCCTT
TCTCGACGTCCTCAGGGTGCTGGTCCCTGGACATGTCGAGGAAGCTGCTCTGCAAATCGGGCGGGCGCAA
TTTTTTAACCTTCCAATAGAACGATTGTCGGAATTCGCCTCTGTGGAGGAGCCCGCGTCGGATCAAGAAA
CGGACAAGGTTTTCACAGTAACGACTAGAGACAATGCACTACAATTACTGTCTAAAATCAGTGCGTTTTA
TCACCAGGCCGAGCCGTCGAGCCCGATCTCCTATCTGATCGAGCGCGCCCGCGCCGTGACCGGCCGCGAT
TTCCTTGGTCTGTTGAAGGACATGCTGCCGCCGGACAGTTTGAAGTCGCTCGATTCGCCGAAGTAG