SecReT6
Protein ID: 217978505
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2360
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2570154..2570705 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB8EIH1
KEGG IDmsl:Msil_2360
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-53, Aligned region: 10..166
Protein Sequence: 183 a.a.     [Download]
>gi|217978505|ref|YP_002362652.1| type VI secretion protein [Methylocella silvestris BL2]
MAGDSGQKFIGRNRPPRVQIAYEDPYDAERKIELPFVMGVLSDLSGPNPGVEKPDVADRGFVDIDMDNFD
KRMGAIEPGTSFTVPDRLGDDPDAAKLSVSLRFKKMEDFGPAAVARQVPALAKLLEARDQLANLLRYMDG
KVDAETRLRKLLSDPELMAALKSRIGATKDAEAETAKTADGDA
 
Nucleotide Sequence: 552 bp     [Download]
>gi|217976200|ref|NC_011666.1|:2570154-2570705 Methylocella silvestris BL2 chromosome, complete genome
ATGGCAGGTGACAGTGGACAGAAATTCATTGGACGCAACCGTCCGCCACGTGTGCAGATTGCTTATGAGG
ATCCCTATGACGCGGAGCGAAAGATAGAGCTGCCCTTCGTCATGGGCGTGCTCTCCGACCTCTCCGGCCC
GAACCCCGGCGTCGAGAAGCCGGACGTCGCCGATCGGGGCTTCGTCGATATCGACATGGATAATTTCGAC
AAGCGCATGGGCGCGATCGAGCCTGGAACATCCTTCACCGTGCCGGACCGGCTTGGCGACGACCCGGACG
CCGCCAAATTGTCGGTCAGCCTGCGCTTCAAGAAGATGGAAGACTTCGGCCCGGCGGCGGTCGCCCGGCA
GGTGCCGGCGCTCGCCAAACTGCTCGAGGCGCGCGACCAGCTGGCAAATCTGTTGCGCTATATGGACGGC
AAGGTCGACGCCGAAACGCGGCTGCGTAAATTGCTGAGCGATCCCGAACTGATGGCGGCGCTGAAAAGCC
GCATCGGCGCGACGAAGGACGCTGAAGCCGAAACCGCCAAGACCGCCGACGGCGACGCTTGA