SecReT6
Protein ID: 217978508
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2363
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2572969..2573517 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB8EIH4
KEGG IDmsl:Msil_2363
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.90E-19, Aligned region: 56..162
Protein Sequence: 182 a.a.     [Download]
>gi|217978508|ref|YP_002362655.1| type VI secretion system lysozyme-like protein [Methylocella silvestris BL2]
MSVPTRKNRLSPPFMHAFRSAFEQKDSRQKQDLRDAAGDRIIAPRRAAVRATISEPNLRREVARDLEALV
NAVAFESTEDLSDFDGVRKSILNYGLPDLIHRTIDEAGVNLIEDEIANALRRYEPRLVANTIKVSRDDNL
DKDELKVRFLVRADLICAPVNVPVEFIADVEIDSGDVVVKKA
 
Nucleotide Sequence: 549 bp     [Download]
>gi|217976200|ref|NC_011666.1|:2572969-2573517 Methylocella silvestris BL2 chromosome, complete genome
ATGTCCGTTCCGACACGAAAAAATCGTCTCAGTCCGCCCTTCATGCACGCCTTCCGCAGCGCCTTCGAGC
AGAAGGACTCGCGCCAGAAACAGGATCTGCGCGACGCCGCCGGCGACCGCATCATCGCGCCGCGCCGCGC
CGCCGTGCGCGCGACGATCAGCGAACCCAATCTGCGCCGCGAAGTCGCGCGCGATCTTGAGGCGCTCGTC
AACGCCGTGGCGTTCGAATCGACCGAGGATCTGTCCGACTTTGACGGCGTCCGCAAATCGATCCTCAATT
ACGGCCTGCCCGATCTCATTCACCGCACCATCGACGAGGCCGGCGTCAACCTCATTGAAGATGAAATCGC
CAACGCCTTGCGGCGCTATGAGCCGCGGCTTGTCGCCAACACCATCAAAGTCTCGCGCGACGACAACCTC
GACAAGGATGAGCTCAAAGTCCGCTTTCTCGTGCGGGCCGATCTCATCTGCGCGCCGGTCAATGTGCCGG
TTGAATTCATCGCCGATGTCGAGATCGACAGCGGCGACGTTGTTGTGAAGAAAGCCTGA