SecReT6
Protein ID: 217978509
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2364
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2573523..2575481 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB8EIH5
KEGG IDmsl:Msil_2364
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.80E-168, Aligned region: 5..650
Protein Sequence: 652 a.a.     [Download]
>gi|217978509|ref|YP_002362656.1| type VI secretion protein [Methylocella silvestris BL2]
MNREFLDHYDRELKLLHEQAREFAEDYPGVAERLGGLLDERMDPMIGGLLEGAAFLAARVQLKLKHEFPE
FTNNLLEQLVPDYLAPTPSVLLLRAEPPYEDAALRDGQNIARGSYLEAVYREQDRQVACRFRLASKITLL
PFEITAAEYYGSPAPLQALGVAVGAEALAGLKISLTHRSAARVEDEPRDAEAAERPDLWFDGCRINELPL
HFLGPEPDAIALYEQIFASAAGVYFRYLDPFGDPVVVPAGTDIIEQIGFRDDEALFPKNERIFSGFEWLR
EYFMFPRKFLGMRLTGLRAILARLPARNIDIIISFKELNPRLQVAVTRNMFALYAAPAINLFEKTIDRVQ
VKSNQHEYHIVPDRSRYLDYEPHRLLSVFAHYRGGADAAPVRPLYSSEAEGGAGALHYAVRRMPRRRTAR
ENKYGASSDYVGTDMFIALVDNSRAGEERPIAELSVTALCSNRHLTEQLPVGQGGADFRLIDNTAIDLRC
IAGPTRPREPIIAQLRSRSESAYAGKVTWRLINLLSLNHLGLVERGAGRNAQALRETVSMFADLSDSATE
RRIRGLRSVDSRPIVRRIRQSGGVGVARGVEVTVTIDEKAFEGSGAFLLGAILDRFYCEYAGFNHFTQTV
IRSVDRGEIMRWPVRAGLRRPL
 
Nucleotide Sequence: 1959 bp     [Download]
>gi|217976200|ref|NC_011666.1|:2573523-2575481 Methylocella silvestris BL2 chromosome, complete genome
ATGAATCGCGAGTTCCTCGACCATTACGATCGCGAACTGAAGCTTCTGCACGAGCAGGCGCGTGAATTCG
CCGAAGATTATCCGGGCGTCGCCGAGCGCCTCGGCGGGTTGCTCGACGAGCGCATGGATCCGATGATCGG
CGGCCTGCTCGAGGGCGCCGCCTTTCTCGCGGCGCGGGTGCAATTGAAGCTGAAACACGAGTTTCCGGAA
TTCACCAATAATCTGCTGGAGCAGCTCGTTCCCGACTATCTTGCGCCGACGCCTTCCGTTCTGCTTCTGC
GCGCCGAGCCCCCTTACGAGGACGCCGCGTTGCGCGACGGGCAGAACATTGCGCGCGGCTCCTATCTCGA
GGCGGTCTACCGCGAGCAGGATCGCCAGGTCGCCTGCCGCTTCCGCCTCGCCTCCAAAATCACGCTGCTG
CCGTTCGAAATCACCGCCGCCGAATATTATGGCTCGCCGGCGCCGCTGCAGGCGCTCGGAGTCGCCGTCG
GCGCCGAGGCGCTGGCCGGCTTGAAGATCTCGCTGACCCACCGCAGCGCCGCGCGCGTCGAGGACGAGCC
GCGCGACGCCGAGGCCGCCGAACGGCCGGACCTCTGGTTCGACGGTTGCCGGATCAACGAATTGCCGCTC
CATTTCCTCGGGCCCGAACCCGACGCGATCGCGCTCTACGAGCAGATCTTCGCCAGCGCGGCCGGCGTCT
ATTTCCGCTATCTCGACCCTTTCGGCGACCCTGTCGTCGTCCCGGCCGGAACGGACATCATCGAGCAGAT
CGGCTTTCGCGACGACGAGGCGCTGTTTCCCAAGAACGAGCGCATTTTTTCCGGCTTCGAATGGCTGCGC
GAATATTTCATGTTCCCGCGCAAGTTTCTTGGAATGCGGCTGACCGGGCTGCGCGCGATCCTCGCCCGCC
TGCCCGCGCGAAACATTGACATCATCATCAGCTTCAAGGAGCTCAATCCGCGCCTGCAGGTCGCCGTCAC
GCGCAACATGTTTGCGCTCTATGCAGCCCCCGCCATCAACCTCTTTGAAAAAACCATCGATCGCGTGCAG
GTCAAATCCAACCAGCACGAATATCATATCGTGCCCGATCGCAGCCGCTATCTCGACTATGAACCGCACC
GGCTGCTTTCGGTCTTCGCGCATTATCGCGGCGGGGCGGACGCGGCGCCCGTGCGCCCGCTATATTCCTC
CGAGGCGGAAGGCGGCGCGGGCGCATTGCATTACGCCGTTCGCCGCATGCCGCGCCGGCGCACGGCGCGG
GAAAACAAATATGGCGCCTCCTCCGATTATGTTGGCACCGACATGTTTATCGCCCTCGTCGACAATTCGC
GCGCGGGCGAGGAGCGGCCGATCGCCGAGCTCAGCGTCACGGCGCTCTGCTCCAACCGTCATCTGACCGA
GCAGCTTCCGGTCGGTCAGGGCGGCGCCGATTTCCGCCTGATCGACAACACCGCGATCGATCTGCGCTGC
ATCGCCGGACCGACGCGGCCGCGCGAGCCGATCATCGCGCAATTGCGCAGCCGCAGCGAATCGGCCTACG
CCGGCAAGGTGACCTGGCGCCTCATCAATCTGCTCAGCCTCAATCATCTCGGCCTCGTCGAGCGCGGCGC
CGGCCGCAATGCGCAGGCGCTGCGCGAAACCGTCTCGATGTTCGCCGATCTTTCCGACAGCGCCACGGAG
CGGCGCATCCGCGGCCTGCGCAGCGTCGACAGCCGCCCCATCGTGCGGCGCATCCGCCAGAGCGGCGGCG
TCGGCGTTGCGCGCGGCGTCGAAGTCACCGTAACGATCGACGAAAAAGCGTTCGAGGGCAGCGGCGCCTT
TTTGCTCGGCGCGATCCTCGACCGCTTCTATTGCGAATATGCGGGCTTCAATCATTTCACGCAGACGGTG
ATCCGCAGCGTCGATCGCGGCGAGATCATGCGCTGGCCGGTGCGCGCCGGCTTACGGAGACCGCTATGA