SecReT6
Protein ID: 217978510
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2365
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2575478..2576527 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB8EIH6
KEGG IDmsl:Msil_2365
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.10E-94, Aligned region: 8..304
Protein Sequence: 349 a.a.     [Download]
>gi|217978510|ref|YP_002362657.1| type VI secretion protein [Methylocella silvestris BL2]
MNLEGAESEPWRFDFFAAMRALERANPTLPRIGDAGALREEYARLGQDPYMDFPASTLSKFETRETHTRI
LTKFLGFLGPQGALPLATTEEAYNWFLAQDDSFPRFLDIINHRFLQLFFRAWADSRPVAQHDRPNDDRFE
TYVGASAGLGSPIYRDLDSVDDRAKLCFAGVLGPQAKSASRLRAFICGHFHVEAEIEEFVGSRLELEPAD
QSKLGSASLGVDMLLGASFYSVQDKVRIRIYVPDMKAYRRFLPDGDFCEPLADIVFFYVGEELDWDLELA
IPAKAAEPVKLGRSGDLGWTSWVAPDWAAADAWRRDARFHPAERMREARARAARTKHQQGRGKTGAENG
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|217976200|ref|NC_011666.1|:2575478-2576527 Methylocella silvestris BL2 chromosome, complete genome
ATGAACCTTGAGGGCGCCGAAAGCGAACCCTGGCGCTTCGACTTCTTCGCGGCGATGCGCGCGCTCGAAC
GCGCCAACCCCACGCTGCCGCGCATTGGCGACGCCGGCGCGCTGCGCGAGGAATATGCAAGGCTCGGCCA
GGACCCTTACATGGATTTTCCGGCCTCGACGCTCTCGAAATTCGAGACGCGCGAGACGCATACGCGAATC
CTCACAAAATTTCTCGGCTTCCTCGGCCCGCAAGGCGCGCTGCCGCTGGCTACTACAGAAGAAGCCTACA
ATTGGTTCCTTGCGCAGGACGATTCCTTCCCGCGCTTTCTCGACATCATCAACCATCGCTTTTTGCAGTT
GTTCTTCCGCGCCTGGGCCGATTCGCGGCCTGTCGCGCAACATGACCGCCCGAACGACGACCGTTTCGAG
ACTTATGTCGGCGCGTCCGCGGGGCTCGGCTCGCCGATCTACCGCGATCTCGATTCGGTCGACGATCGCG
CGAAGCTGTGCTTTGCCGGCGTGCTCGGCCCCCAGGCCAAATCCGCCTCCCGCCTTCGCGCCTTCATTTG
CGGACATTTCCACGTCGAGGCGGAGATTGAGGAATTTGTCGGCTCGCGGCTGGAGCTTGAGCCCGCCGAC
CAATCGAAGCTTGGCTCCGCCTCGCTCGGCGTCGATATGCTGCTTGGCGCAAGTTTCTACAGCGTGCAGG
ACAAGGTGCGCATTCGCATCTATGTGCCGGACATGAAAGCCTACCGTCGCTTTTTACCGGACGGCGATTT
CTGCGAACCGCTTGCCGACATCGTCTTCTTCTATGTCGGCGAGGAGCTCGACTGGGACCTCGAACTTGCG
ATCCCGGCCAAGGCGGCCGAGCCTGTCAAACTTGGACGCTCCGGCGATCTTGGCTGGACGAGCTGGGTTG
CGCCCGATTGGGCGGCGGCGGACGCCTGGCGCCGGGACGCGCGATTCCATCCGGCCGAACGCATGCGCGA
AGCGCGGGCGCGCGCGGCAAGGACGAAACATCAACAAGGCCGCGGCAAGACGGGAGCAGAGAATGGCTGA