SecReT6
Protein ID: 217978511
SecReT6 ID313
T6SS typei3
Gene symbol-
Locus tagMsil_2366
StrainMethylocella silvestris BL2
Repliconchromosome [GenBank: NC_011666] [Browse all T6SS(s) in this replicon]
Location [Strand]2576520..2579234 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDB8EIH7
KEGG IDmsl:Msil_2366
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.30E-42, Aligned region: 231..254
AAA_2 [PF07724], Evalue: 3.30E-42, Aligned region: 610..776
AAA [PF00004], Evalue: 4.00E-21, Aligned region: 232..363
AAA [PF00004], Evalue: 4.00E-21, Aligned region: 616..700
ClpB_D2-small [PF10431], Evalue: 3.80E-14, Aligned region: 783..859
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 232..253
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 454..509
AAA_5 [PF07728], Evalue: 1.00E-13, Aligned region: 615..734
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 35..69
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 209..255
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 499..504
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 606..658
AAA_16 [PF13191], Evalue: 1.80E-11, Aligned region: 681..701
AAA_22 [PF13401], Evalue: 8.20E-09, Aligned region: 231..317
AAA_22 [PF13401], Evalue: 8.20E-09, Aligned region: 514..574
AAA_22 [PF13401], Evalue: 8.20E-09, Aligned region: 613..649
Sigma54_activat [PF00158], Evalue: 6.90E-07, Aligned region: 219..253
Sigma54_activat [PF00158], Evalue: 6.90E-07, Aligned region: 615..728
IstB_IS21 [PF01695], Evalue: 1.60E-06, Aligned region: 215..254
IstB_IS21 [PF01695], Evalue: 1.60E-06, Aligned region: 615..636
IstB_IS21 [PF01695], Evalue: 1.60E-06, Aligned region: 724..749
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 232..266
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 466..502
AAA_17 [PF13207], Evalue: 2.10E-06, Aligned region: 615..651
AAA_14 [PF13173], Evalue: 3.60E-06, Aligned region: 232..312
AAA_14 [PF13173], Evalue: 3.60E-06, Aligned region: 614..696
AAA_19 [PF13245], Evalue: 3.60E-06, Aligned region: 232..258
AAA_19 [PF13245], Evalue: 3.60E-06, Aligned region: 613..637
Zeta_toxin [PF06414], Evalue: 3.60E-05, Aligned region: 231..253
Zeta_toxin [PF06414], Evalue: 3.60E-05, Aligned region: 607..665
AAA_18 [PF13238], Evalue: 7.30E-05, Aligned region: 232..252
AAA_18 [PF13238], Evalue: 7.30E-05, Aligned region: 489..503
AAA_18 [PF13238], Evalue: 7.30E-05, Aligned region: 617..644
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 228..254
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 271..320
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 613..640
NACHT [PF05729], Evalue: 0.00013, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.00013, Aligned region: 616..642
Arch_ATPase [PF01637], Evalue: 0.00024, Aligned region: 211..252
Arch_ATPase [PF01637], Evalue: 0.00024, Aligned region: 283..315
Arch_ATPase [PF01637], Evalue: 0.00024, Aligned region: 614..646
AAA_29 [PF13555], Evalue: 0.00056, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.00056, Aligned region: 613..640
RNA_helicase [PF00910], Evalue: 0.00067, Aligned region: 233..254
RNA_helicase [PF00910], Evalue: 0.00067, Aligned region: 616..637
NTPase_1 [PF03266], Evalue: 0.0009, Aligned region: 232..257
NTPase_1 [PF03266], Evalue: 0.0009, Aligned region: 615..637
AAA_30 [PF13604], Evalue: 0.0021, Aligned region: 223..260
AAA_30 [PF13604], Evalue: 0.0021, Aligned region: 614..646
SRP54 [PF00448], Evalue: 0.0024, Aligned region: 232..257
SRP54 [PF00448], Evalue: 0.0024, Aligned region: 614..648
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 227..251
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 614..629
UPF0079 [PF02367], Evalue: 0.0057, Aligned region: 232..253
UPF0079 [PF02367], Evalue: 0.0057, Aligned region: 613..643
Protein Sequence: 904 a.a.     [Download]
>gi|217978511|ref|YP_002362658.1| type VI secretion ATPase, ClpV1 family [Methylocella silvestris BL2]
MADISLEAVTGKLNRIGYETFIQALRQAKGAGNRNVELAHWLAHIMQKERSDLALTADHFKLDRAKLASD
IARTIDGFRRNETEMPGVSNTLVDLLDRGWHYATLFFGETQIRTGHVLAGALKSLELRRAFTSISPEFAK
IPGDALTNEYRSLWAGSDEENLQPMDGSGLSAAGTPGAEQAQGAKGTTALDRFSQDLTARAATGEMDPVL
GRDDEIRQIIDVLMRRRQNNPILTGEAGVGKTAIVEGLAQRIAASDVPPALRGVRLLALDITLMQAGASM
KGEFEQRLRSVIDEVQASPKPIILFIDEAHTLIGAGGAAGTGDAANILKPALARGTLRTIAATTWAEYRQ
YFEKDPALTRRFQPVQVDEPDVARCCVMLRGVLAPMEKHHKVRISDAAIVAAVNLSHRYIPARLLPDKAV
SLLDTTCARVAISQNATPAAVEDARVAANALEAEKAALTTDADLGDLDEERIGEIDAELAELKEKSAALE
EEWAKERALIEEIVKLRREISENPADAEQKRVALRDKIASLGGVDPEKRMIYAHVDDQSVAAVVSDWTGI
PVGRMVKDEIENVLRLPEILNRRVVGQSHGLAMIAKRIETNRAGLDNPSKPIGVFMLCGPSGVGKTETAL
ALAEALYGGEQNIITINMSEFQEAHTVSGLKGAPPGYVGYGEGGRLTEAVRRKPYSVVLLDEIEKAHPDV
HELFFQVFDKGVMEDGTGRRIDFKNTLIILTSNVGTDTIMRRAEDPAFAGDAEALAAELRPDLLQVFPPA
LLGRLVTIPYLPLSPSMLAGIVRLQLGRIGKRIRAAQDADFSYDDAVVDHIVSLCNDPDSGGRIIDNIIN
NTLLPALSREFLKRTLAKQELKEARVAMKDGAFAYEWIGASPCAPAQTEHSAEFSLEETQQPVE
 
Nucleotide Sequence: 2715 bp     [Download]
>gi|217976200|ref|NC_011666.1|:2576520-2579234 Methylocella silvestris BL2 chromosome, complete genome
ATGGCTGACATCAGTCTCGAAGCCGTAACGGGGAAGCTGAACAGAATCGGCTATGAGACCTTCATCCAGG
CGCTGCGCCAGGCGAAGGGCGCCGGCAACCGCAATGTCGAGCTCGCGCATTGGCTGGCGCATATCATGCA
AAAGGAGCGCTCCGACCTTGCCCTGACAGCCGATCATTTCAAGCTCGATCGCGCAAAGCTCGCCAGCGAC
ATCGCGCGGACCATTGACGGCTTTCGCCGCAACGAAACGGAGATGCCGGGCGTCTCCAACACGCTCGTCG
ATCTGCTCGATCGCGGCTGGCATTATGCGACGCTGTTTTTCGGCGAAACGCAGATCCGCACGGGGCACGT
TCTGGCAGGCGCCCTGAAGTCGCTGGAGCTGCGCCGCGCCTTCACGTCGATCTCGCCGGAGTTTGCGAAA
ATCCCCGGCGACGCTCTGACCAATGAGTATCGCTCGCTCTGGGCCGGCTCGGATGAAGAGAATTTGCAGC
CGATGGATGGCTCCGGCCTCAGCGCCGCGGGAACGCCGGGCGCCGAGCAGGCGCAAGGCGCCAAGGGCAC
GACGGCGCTTGATCGCTTCTCACAGGATCTCACCGCCCGGGCCGCAACCGGCGAGATGGACCCCGTGCTC
GGGCGCGATGACGAGATCCGCCAGATCATCGACGTGCTGATGCGCCGGCGGCAGAACAATCCGATCCTGA
CCGGCGAGGCCGGCGTCGGCAAAACCGCAATCGTGGAAGGGCTGGCGCAGCGCATCGCCGCAAGCGACGT
TCCCCCTGCGCTGCGCGGCGTTCGATTGCTCGCGCTCGATATCACGCTGATGCAGGCCGGCGCCTCGATG
AAGGGCGAATTCGAGCAGCGCCTGCGCTCCGTCATCGACGAGGTGCAGGCCTCGCCAAAGCCGATCATCC
TCTTTATCGACGAGGCGCATACGTTGATCGGCGCCGGCGGCGCGGCCGGCACGGGCGACGCGGCGAACAT
TCTAAAGCCTGCGCTCGCGCGCGGCACGCTGCGCACCATCGCCGCGACCACATGGGCCGAATACAGGCAG
TATTTCGAGAAGGATCCGGCGCTCACCCGCAGGTTCCAGCCGGTGCAGGTCGACGAGCCGGACGTCGCGC
GCTGCTGCGTGATGCTGCGCGGCGTGCTCGCGCCGATGGAAAAGCACCACAAGGTGCGCATTTCCGACGC
CGCGATCGTAGCTGCGGTCAATCTCTCGCATCGCTATATTCCCGCGCGCCTGTTGCCGGACAAGGCGGTG
AGCCTGCTCGACACCACCTGCGCGCGGGTCGCGATTAGCCAGAACGCGACGCCGGCCGCGGTCGAGGATG
CGCGCGTCGCGGCAAACGCGCTTGAGGCTGAAAAAGCCGCCCTCACCACCGACGCCGATCTTGGCGATCT
CGACGAGGAGCGCATCGGCGAGATCGACGCCGAACTCGCCGAGCTTAAGGAAAAGAGCGCGGCGCTCGAG
GAAGAATGGGCGAAGGAGCGCGCTCTGATCGAGGAGATCGTGAAGCTGCGCCGGGAGATCAGCGAAAATC
CGGCGGACGCGGAGCAAAAGCGCGTCGCGCTCAGGGACAAAATCGCCTCCCTCGGCGGCGTCGATCCCGA
GAAGCGGATGATCTACGCCCATGTCGACGACCAGTCGGTCGCCGCCGTCGTCTCGGATTGGACCGGCATT
CCGGTCGGCCGCATGGTCAAGGACGAGATCGAGAATGTGCTGCGCCTGCCGGAAATTCTGAACCGGCGCG
TCGTCGGCCAGTCGCATGGCCTCGCCATGATCGCCAAGCGCATCGAGACCAATCGCGCCGGCCTCGACAA
TCCGTCAAAGCCGATCGGCGTCTTCATGCTGTGCGGACCCTCGGGCGTCGGCAAGACGGAGACGGCGCTG
GCGCTGGCCGAGGCCCTCTATGGCGGCGAGCAGAATATCATTACGATCAACATGTCGGAATTTCAGGAGG
CGCACACCGTCTCTGGACTGAAAGGCGCGCCCCCCGGCTATGTCGGCTATGGCGAGGGCGGCCGCCTGAC
GGAGGCCGTCCGCCGCAAGCCCTATAGCGTCGTGCTGCTCGACGAGATCGAGAAGGCCCATCCCGACGTG
CATGAGCTGTTCTTTCAGGTCTTCGACAAGGGCGTCATGGAGGACGGCACGGGGCGGCGCATCGATTTTA
AGAATACGCTCATCATACTGACGTCGAACGTCGGCACAGACACCATCATGCGGAGAGCCGAAGACCCCGC
TTTCGCCGGAGACGCAGAGGCTCTGGCGGCGGAGCTCAGGCCCGACCTGTTGCAGGTCTTTCCGCCCGCG
CTGCTCGGGCGTCTCGTGACCATCCCCTATCTGCCGCTGTCGCCGTCCATGCTGGCCGGCATCGTGCGGC
TGCAGCTCGGGCGGATCGGCAAGCGCATCCGCGCGGCGCAGGACGCCGACTTCAGCTATGACGACGCCGT
GGTCGATCATATCGTCTCGCTCTGCAACGATCCGGATTCGGGCGGCCGCATCATCGACAACATCATCAAC
AACACGCTGTTGCCGGCGCTCTCGCGCGAATTTTTGAAGCGCACGCTTGCGAAACAGGAACTGAAAGAGG
CGCGTGTGGCGATGAAAGACGGCGCCTTCGCTTATGAATGGATCGGAGCCTCGCCGTGCGCCCCGGCACA
GACCGAACATTCCGCCGAGTTCAGTCTGGAGGAAACGCAACAGCCTGTGGAATGA