SecReT6
Protein ID: 218549300
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1962
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2008475..2008954 [-]
Producthypothetical protein
NoteTssD
UniProt IDB7LTR2
KEGG IDefe:EFER_1962
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-29, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|218549300|ref|YP_002383091.1| hypothetical protein EFER_1962 [Escherichia fergusonii ATCC 35469]
MANLIYLTLNGQNQGLISAGCSSLDSIGNKAQLVHLDQIMVFELTHGLSRNQNVNHHSVTIKKPIDKSSP
LLGKAINDNEILTCDFDFYRTNRFGVNEKYYKIKLTNARISDIHLYAPHSINDNSGQTQETISFVYETIN
WEHCTAGTSGYSLWNERIF
 
Nucleotide Sequence: 480 bp     [Download]
>ref|NC_011740.1|:c2008954-2008475 hypothetical protein EFER_1962 [Escherichia fergusonii ATCC 35469]
ATGGCTAATTTAATTTATCTGACACTGAATGGACAAAACCAGGGACTGATATCAGCAGGATGTTCCTCAC
TGGACTCTATTGGTAATAAAGCCCAATTGGTACATCTTGACCAGATTATGGTGTTTGAGTTAACGCACGG
TTTAAGTCGTAACCAGAATGTCAATCATCATTCCGTCACCATAAAAAAGCCAATTGATAAATCATCGCCT
TTACTCGGTAAAGCGATTAACGACAATGAAATACTAACCTGCGATTTTGATTTTTACCGGACAAATCGCT
TTGGGGTTAACGAAAAATACTACAAGATAAAACTCACTAATGCCAGAATTAGCGATATTCATTTATATGC
ACCTCACTCTATTAATGATAATTCAGGGCAAACTCAGGAAACGATATCATTTGTATATGAAACCATAAAC
TGGGAGCATTGCACAGCCGGGACAAGCGGATATAGTTTATGGAATGAGAGAATCTTTTGA