SecReT6
Protein ID: 218549301
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1963
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2008972..2010477 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7LTR3
KEGG IDefe:EFER_1963
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.20E-43, Aligned region: 181..204
DUF3702 [PF12486], Evalue: 3.20E-43, Aligned region: 341..485
ImpA-rel_N [PF06812], Evalue: 4.90E-21, Aligned region: 90..149
Protein Sequence: 501 a.a.     [Download]
>gi|218549301|ref|YP_002383092.1| hypothetical protein EFER_1963 [Escherichia fergusonii ATCC 35469]
MRQGHSACGLTWTVARWSTGYTLTPRTIHSVAGFSASSGCRTRCTEETRMSNNVLTQTIVTGSDPRGLPE
FSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLTGFCEGAELLAAMVT
HEWDNFWPQGGPARTEMLDWFNTRTGNILRQQISFVEADLPLLYRTERALQLICDKLQQVELKRQPRVEN
LLYFVQNTRKRLEPQPKSSVEHTAQTTVRTLIYAPENGTALATETVMPPLPELPEMKVEVRSLADSTPLA
SVAKQGSAAKGFIAGVVCSAAVVAALCWWLVSPMQQQLNQVRDTAQGAATVWLASPELENYERRLQQLLD
APPVQPLDTGVQMARTADSRWPESLQQQQATAQWNETLKTRAQSSPQLRGWLQTRQDLHAFADLVMKREK
EGVTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQGQNTDVLEKQINERLDGVLSRWLLLKNQTMPE
TATGAKSGSNN
 
Nucleotide Sequence: 1506 bp     [Download]
>ref|NC_011740.1|:c2010477-2008972 hypothetical protein EFER_1963 [Escherichia fergusonii ATCC 35469]
TTGAGGCAGGGACATTCAGCGTGCGGTTTAACGTGGACGGTGGCGCGATGGTCTACCGGATACACGCTGA
CACCGAGGACAATCCATTCAGTGGCGGGCTTTTCAGCCAGTTCAGGCTGTCGGACACGCTGTACTGAGGA
GACAAGGATGAGCAATAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCGTGGCCTGCCAGAG
TTCAGCGCCATCCGCGAGGAAATCAACAAGGCCAGCCATCCGTCGCAGCCGGAGCTGAACTGGAAACTGG
TGGAGTCGCTGGCGCTGGCGATATTTAAGGCCAACGGCGTGGATTTGCATACCGCCACCTACTACACGCT
GGCCCGGACCCGGACACAGGGGCTGACGGGATTCTGCGAAGGGGCGGAGCTGCTGGCGGCGATGGTGACT
CACGAGTGGGATAATTTCTGGCCGCAGGGCGGCCCGGCGCGGACCGAGATGCTGGACTGGTTCAACACCC
GCACCGGGAATATCCTGCGCCAGCAGATATCCTTTGTGGAGGCTGACCTGCCCCTGTTATACCGTACAGA
ACGGGCATTACAGCTTATCTGCGACAAACTCCAGCAGGTGGAACTGAAGCGCCAGCCGCGTGTGGAAAAC
CTGCTTTATTTTGTCCAGAACACCCGTAAACGGCTTGAGCCGCAGCCGAAAAGCAGCGTTGAACACACCG
CACAGACCACGGTCAGAACGCTGATTTATGCCCCGGAAAACGGCACTGCGCTGGCAACTGAAACGGTGAT
GCCGCCGCTGCCCGAACTGCCGGAGATGAAGGTGGAAGTGCGCAGCCTGGCTGACAGCACGCCACTGGCC
AGTGTGGCAAAGCAGGGCAGTGCGGCGAAAGGTTTTATCGCGGGTGTTGTCTGCTCTGCGGCTGTCGTCG
CCGCGCTCTGTTGGTGGCTGGTCTCTCCCATGCAACAACAACTCAACCAGGTCCGTGACACCGCGCAGGG
CGCTGCGACAGTCTGGCTGGCGTCGCCTGAACTGGAAAACTATGAGCGCAGGCTACAGCAACTCCTTGAT
GCCCCTCCGGTTCAGCCGCTGGATACGGGCGTGCAGATGGCGCGTACCGCCGACAGTCGCTGGCCGGAGA
GCCTGCAACAGCAGCAGGCTACCGCACAGTGGAATGAGACGCTGAAAACCCGCGCACAGAGTAGTCCACA
GTTACGCGGCTGGTTACAGACCCGCCAGGACTTACATGCCTTTGCAGACCTCGTGATGAAACGTGAGAAA
GAGGGGGTAACCCTTTCCTACATCAAAAATGTTATCTGGCAGGCGGAGCGGGGGCTGGGGCAGGAAACAC
CCGTTGAGTCCCTGCTGACGCAGTACCAGGACGCCCGTGCGCAGGGGCAGAATACCGACGTGCTGGAAAA
ACAGATTAATGAGCGGCTGGACGGCGTGTTAAGTCGTTGGCTATTGCTGAAAAATCAAACGATGCCGGAG
ACGGCGACCGGAGCAAAATCCGGCAGTAATAACTGA