SecReT6
Protein ID: 218549305
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1967
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2016057..2018783 [-]
ProductATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity
NoteTssH
UniProt IDB7LTR7
KEGG IDefe:EFER_1967
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-38, Aligned region: 261..261
AAA_2 [PF07724], Evalue: 1.70E-38, Aligned region: 631..792
AAA [PF00004], Evalue: 7.90E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 7.90E-17, Aligned region: 637..754
AAA_5 [PF07728], Evalue: 7.60E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.60E-14, Aligned region: 636..756
ClpB_D2-small [PF10431], Evalue: 2.20E-12, Aligned region: 798..874
AAA_16 [PF13191], Evalue: 4.90E-11, Aligned region: 121..158
AAA_16 [PF13191], Evalue: 4.90E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.90E-11, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 4.90E-11, Aligned region: 419..499
AAA_16 [PF13191], Evalue: 4.90E-11, Aligned region: 607..677
AAA_16 [PF13191], Evalue: 4.90E-11, Aligned region: 702..730
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 429..483
AAA_22 [PF13401], Evalue: 1.10E-07, Aligned region: 635..670
AAA_25 [PF13481], Evalue: 3.50E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.50E-05, Aligned region: 446..488
AAA_25 [PF13481], Evalue: 3.50E-05, Aligned region: 631..665
AAA_14 [PF13173], Evalue: 8.40E-05, Aligned region: 222..322
AAA_14 [PF13173], Evalue: 8.40E-05, Aligned region: 636..726
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 634..661
DUF258 [PF03193], Evalue: 0.00022, Aligned region: 195..239
DUF258 [PF03193], Evalue: 0.00022, Aligned region: 637..655
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 630..658
NACHT [PF05729], Evalue: 0.00024, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.00024, Aligned region: 283..345
NACHT [PF05729], Evalue: 0.00024, Aligned region: 478..516
NACHT [PF05729], Evalue: 0.00024, Aligned region: 637..665
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 202..236
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 276..308
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 637..657
Arch_ATPase [PF01637], Evalue: 0.0052, Aligned region: 707..718
AAA_18 [PF13238], Evalue: 0.0063, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0063, Aligned region: 637..671
Zeta_toxin [PF06414], Evalue: 0.0077, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0077, Aligned region: 635..676
IstB_IS21 [PF01695], Evalue: 0.0078, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0078, Aligned region: 636..647
Protein Sequence: 908 a.a.     [Download]
>gi|218549305|ref|YP_002383096.1| ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity [Escherichia fergusonii ATCC 35469]
MIQIDLAALVKRLNPFTKQALEMAASECMSQQSAEITVSHVLIQMLAIPRSDLRVITEQVDITVDTLRQS
LTEERYATVRMADGYPAFSPMLVEWLKEGWLLASAEMQHNELRGGVLLLALLHSPLRYVPPAVARLLTGI
NRDRLQQDFAQWTRESAETAMRNADGQTMNTMVDTGDSLLARYAKNMTADARNGRLDPVLCRDHEIDLML
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISVLTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLAALDELEAAWHQQQTL
VREIIALRQQLLGVDAMEDTPSESEQDNTDAESTDDAGSTQPEETAETVSPVQRLTQLTAELDTLHNDRL
LVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLTARADLRRPG
RPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEA
IRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHAGDPETM
QEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLTRLDNVLRSRFGAEVIIEPEVTDEIMSRV
TRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAADGAFTADVEDAQNDESVTEDEAVL
 
Nucleotide Sequence: 2727 bp     [Download]
>ref|NC_011740.1|:c2018783-2016057 ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity [Escherichia fergusonii ATCC 35469]
ATGATTCAGATTGATTTAGCTGCACTGGTTAAGCGCCTTAACCCGTTCACCAAACAGGCGCTGGAAATGG
CGGCTTCAGAATGCATGAGCCAGCAGTCGGCAGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATACCGCGAAGCGATCTGCGGGTTATTACAGAGCAGGTGGACATTACCGTGGACACGCTACGCCAGTCG
TTAACAGAGGAGCGCTATGCCACTGTACGAATGGCAGACGGCTACCCGGCATTTTCTCCGATGCTGGTTG
AATGGCTGAAAGAGGGCTGGCTGCTGGCCTCCGCAGAGATGCAGCACAACGAACTGCGTGGCGGTGTACT
GTTGCTGGCGCTTCTGCACTCGCCGTTGCGTTATGTTCCGCCCGCCGTTGCCCGACTGCTGACCGGCATT
AACCGCGACCGCCTGCAACAGGATTTTGCGCAGTGGACGCGCGAGTCAGCAGAAACCGCGATGCGGAATG
CTGACGGTCAGACCATGAATACGATGGTGGATACAGGGGACAGCCTGCTTGCCCGCTACGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGCTC
GACATTCTCTGCCGCCGCCGTAAAAACAATCCGGTAGTGGTGGGTGAAGCAGGCGTGGGTAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACCTGGGTGCATTACAGGCCGGGGCATCGGTGAAGGGCGAATTCGAAAAACGCTTCAAGGGG
CTGATGGCGGAGGTTATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGTGGGCTGGATATCTCCAACCTGCTGAAACCAGCGCTGGCGCGCGGCGAACT
GAAAACCATCGCCGCCACCACATGGAGCGAATACAAAAAATACTTCGAGAAAGACGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCCGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGTGA
GCGTTATCTCTCCGGGCGTCAGTTGCCGGACAAAGCCATTGATGTGCTGGATACCGCCTGCGCCCGCGTG
GCCATCAACCTGTCATCGCCGCCGAAGCAAATCTCGGTGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGGCTGCGTACCGACACCTCACGGATGACCGAGGTACT
GGTGCAGTATGATGAAACACTGGCGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTACGGGAAATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGATGCCATGGAGGATACGCCGTCAGAGT
CAGAACAGGATAATACCGATGCTGAATCGACTGATGATGCTGGCAGCACACAGCCTGAAGAGACCGCTGA
AACAGTTTCCCCGGTGCAGAGGCTGACCCAGCTCACCGCCGAACTGGACACCCTGCATAACGACCGGTTG
CTGGTTTCCCCGCATGTCGATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACTGGCGTTCCGCTTA
ACCGCCTGTCGCAGAATGAAATGTCGGTCATCACCGACCTGCCGAAGTGGCTTGGTGACACCATCAAAGG
ACAGGACCTGGCGATTGCCAGCCTGCATAAACACCTGCTGACTGCACGCGCCGACCTGCGCCGTCCGGGA
CGCCCGCTGGGCGCGTTCCTGCTGGCCGGCCCCAGCGGCGTGGGTAAAACCGAAACCGTCCTGCAACTGG
CAGAACTGCTCTACGGCGGTCGCCAGTATCTGACCACCATCAATATGTCCGAGTTCCAGGAGAAGCACAC
CGTCTCGCGGCTGATTGGTTCCCCTCCGGGCTATGTCGGGTATGGTGAAGGCGGCGTGCTGACCGAAGCG
ATTCGCCAGAAACCTTATTCTGTGGTGTTGCTCGACGAAGTGGAAAAAGCGCACCCGGATGTGCTTAACC
TGTTCTACCAGGCGTTCGACAAGGGCGAGATGGCAGACGGCGAAGGCCGCCTGATTGACTGTAAAAACAT
CGTCTTCTTCCTCACCTCCAACCTCGGCTATCAGGTGATTGTCGAACACGCCGGTGACCCAGAAACCATG
CAGGAAGCCCTGTATCCGGTGCTGGCGGACTTCTTTAAACCTGCCCTGCTGGCGCGTATGGAAGTGGTGC
CGTACCTGCCGCTGTCGAAAGAGACGCTCGCCACCATCATTGCCGGGAAACTCACCCGTCTGGATAACGT
GCTGCGCAGCCGCTTTGGTGCAGAAGTGATTATTGAACCGGAAGTAACGGACGAAATCATGAGCCGCGTC
ACCCGCGCGGAAAACGGCGCGAGGATGCTCGAATCGGTCATCGACGGCGACATGCTGCCGCCGCTCTCCC
TGCTGCTGTTGCAGAAAATGGCGGCCAACACGGCGATTGCCCGGATTCGTCTGTCGGCGGCAGACGGTGC
ATTCACGGCAGACGTGGAAGATGCTCAGAACGACGAGTCCGTCACAGAGGATGAAGCTGTTTTATGA