SecReT6
Protein ID: 218549307
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1969
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2019594..2021051 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7LTR9
KEGG IDefe:EFER_1969
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.90E-140, Aligned region: 54..480
Protein Sequence: 485 a.a.     [Download]
>gi|218549307|ref|YP_002383098.1| hypothetical protein EFER_1969 [Escherichia fergusonii ATCC 35469]
METDRAGGWRRPQLPPAGTCTTGQYRNEKRGQLIMATIKNKVIWQEGLFVQPQHFQQQQRYNDYILGNRL
NAQSDFFWGFTRLSLNIDLLSQGKIHIDHAEGCMPDGTVFSIPDQDLLPEPLEPKVLNTPESHIIYLALP
VISDVINEVDGHHSAGQSSRRYRLNYADVRDLHTDEGDVRQLLLAQLTPRIVGGGEDRSGMVTLPLCRIR
DRLANGALVLDENFIPTCQSVRVSNTLGRFAGEIQGLVASRAIELASRIGSPEQSGIADVAEFMMLQILN
RNQMHFTHRSHLHTLHPEDFYLDLVKLLGELMTFTENSRLPCPVEPYDHHDLTLSFNTVIPELRRTLNIV
LMPRAQNLPLRFMDGIYTATVNDPTLLQSASFVLAVRARMPHNQIILQFTQQSKVAASNKIRDVVSVQVP
GIPLVPRTAAPRQLPYHEGFVYFDLDKGASAWQDVVKAGALSLHISGTFPELDMQLWAIRGQAHE
 
Nucleotide Sequence: 1458 bp     [Download]
>ref|NC_011740.1|:c2021051-2019594 hypothetical protein EFER_1969 [Escherichia fergusonii ATCC 35469]
GTGGAAACAGATAGAGCCGGTGGATGGCGTCGGCCACAACTACCGCCTGCTGGTACATGTACGACAGGGC
AGTATCGAAATGAAAAAAGAGGACAACTGATAATGGCGACCATTAAAAATAAGGTGATCTGGCAGGAGGG
GCTATTTGTTCAGCCACAGCATTTTCAGCAACAGCAACGTTATAACGATTATATCCTTGGTAATCGCCTG
AATGCTCAGAGTGACTTTTTCTGGGGATTCACCCGGTTGTCTCTCAATATCGACTTATTGAGCCAGGGTA
AAATTCATATTGATCATGCTGAAGGCTGTATGCCGGACGGCACGGTTTTCAGCATTCCTGATCAGGATTT
ACTGCCAGAGCCATTAGAACCAAAGGTACTGAATACACCTGAAAGCCACATCATTTATCTGGCCTTGCCC
GTTATTAGTGATGTTATTAATGAAGTGGATGGCCACCACAGCGCCGGGCAGAGTTCCCGACGTTATCGTC
TTAACTATGCCGATGTACGCGATTTACACACCGATGAAGGGGATGTCAGGCAACTGTTGCTGGCGCAGCT
TACCCCCAGGATTGTCGGCGGTGGTGAGGATCGGAGCGGTATGGTCACGCTGCCTTTGTGCCGTATCCGC
GATAGGTTGGCTAATGGCGCACTGGTGCTGGATGAAAACTTTATTCCCACCTGCCAGTCTGTTCGCGTTA
GCAACACGCTGGGTCGGTTTGCCGGAGAGATTCAGGGGCTGGTCGCCAGCCGGGCAATTGAACTGGCAAG
TCGTATTGGTTCGCCGGAACAAAGCGGCATTGCCGATGTGGCCGAGTTTATGATGTTGCAGATCCTCAAC
CGTAACCAGATGCACTTCACTCACCGCTCACACCTGCACACCCTGCATCCGGAGGATTTTTATCTGGATC
TGGTGAAATTACTGGGCGAACTGATGACTTTCACTGAGAACAGTCGTTTGCCCTGTCCTGTGGAGCCTTA
CGATCACCACGATCTCACCTTGTCGTTTAATACAGTGATCCCGGAATTACGCAGGACGCTTAATATCGTG
CTGATGCCACGGGCTCAAAACCTGCCATTGCGCTTTATGGACGGAATTTATACCGCCACTGTTAACGATC
CGACGTTGTTGCAGTCTGCTTCCTTTGTGCTGGCTGTCCGGGCGCGAATGCCGCATAACCAGATTATTCT
CCAGTTTACCCAGCAGTCGAAAGTTGCCGCCAGCAATAAAATTCGCGATGTGGTCAGCGTACAGGTTCCG
GGTATTCCGCTGGTTCCACGGACCGCAGCACCGCGTCAGTTGCCATACCATGAAGGTTTTGTTTATTTCG
ACCTGGATAAAGGTGCATCAGCCTGGCAGGACGTGGTGAAAGCCGGTGCGCTGTCACTGCATATTTCCGG
CACCTTCCCGGAGCTGGACATGCAACTGTGGGCGATAAGGGGCCAGGCTCATGAGTGA