SecReT6
Protein ID: 218549308
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1970
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2020952..2021485 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB7LTS0
KEGG IDefe:EFER_1970
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-32, Aligned region: 18..170
Protein Sequence: 177 a.a.     [Download]
>gi|218549308|ref|YP_002383099.1| hypothetical protein EFER_1970 [Escherichia fergusonii ATCC 35469]
MTGRFFRVCAMVMLFNITLTGCETVKKISQVIKNPDIPVGKITEQPSEVTVTLLTEPDTNTNADGEAAAV
DVQLVYLSDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSD
DQATEWKQIEPVDGVGHNYRLLVHVRQGSIEMKKEDN
 
Nucleotide Sequence: 534 bp     [Download]
>ref|NC_011740.1|:c2021485-2020952 hypothetical protein EFER_1970 [Escherichia fergusonii ATCC 35469]
ATGACTGGGCGTTTTTTCCGTGTCTGCGCAATGGTGATGCTGTTCAACATCACTCTGACGGGATGCGAAA
CAGTGAAAAAAATCAGTCAGGTGATCAAAAACCCGGATATCCCGGTTGGGAAGATAACTGAACAACCCTC
TGAGGTTACGGTTACGTTGCTGACCGAACCGGACACGAATACCAATGCGGACGGCGAAGCAGCGGCTGTG
GATGTACAACTGGTCTATCTGAGTGACGACTCGAAGTTGCAGGCTGCGGACTATGACCAGATTGCCAGTA
CGCCACTGCCGGATGTGCTGGGTAAAAACTATATCGATCATCAGGATTTTAATCTGCTGCCGGACACCAT
CAAAACCCTGCCGCCAGTGAAGCTGGATGAGAAAACGCAGTTTATTGGCGTTGTGGCCTATTTTTCTGAT
GACCAGGCCACCGAGTGGAAACAGATAGAGCCGGTGGATGGCGTCGGCCACAACTACCGCCTGCTGGTAC
ATGTACGACAGGGCAGTATCGAAATGAAAAAAGAGGACAACTGA