SecReT6
Protein ID: 218549309
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1971
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2021482..2022762 [-]
Producthypothetical protein
NoteFha
UniProt IDB7LTS1
KEGG IDefe:EFER_1971
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 426 a.a.     [Download]
>gi|218549309|ref|YP_002383100.1| hypothetical protein EFER_1971 [Escherichia fergusonii ATCC 35469]
MAENKQSSPSLLLQVMNGGELESGRPAKCLFTREGGAIGSAEDCHWSVQDREQTVTDKACAVVMSGSVFC
LKNLSGQIWINQAPVAATSALIQLRQGDEILLGSLLLKVFLSEGKHTDYDEQMAAPETIVTNRDRLVDIL
LTTEGQPEYPGMSRKHQMADTVVNSFSTDPLQVLQTESLTVAGSLFSDTPPGRSSSLLSGTARNNEIDTP
FMDLPPIYAEPRDKDTPVEMAQRHLAVTPLLRGLGCSLTVHNSKEADDFLEEVGRTLQAAIKGLLDLQQR
RNSLSDKHLRPLEDNPLRLNMSYDSALDVMFAEGKSPVHLAAPAAVGESLRNIRHHDDANRAAIVESLRV
LLDAFSPQSLIRRFVQYRRSHELRQPLDDAGAWQMYCNYYDELASDRQQGFEMLFNEVYAQVYDRVLREK
QREPEA
 
Nucleotide Sequence: 1281 bp     [Download]
>ref|NC_011740.1|:c2022762-2021482 hypothetical protein EFER_1971 [Escherichia fergusonii ATCC 35469]
ATGGCTGAGAACAAACAATCTTCTCCTTCACTTCTGTTACAGGTGATGAATGGTGGTGAACTGGAAAGTG
GGCGGCCCGCAAAATGCCTGTTTACCCGTGAAGGAGGTGCTATTGGTAGTGCAGAGGATTGCCACTGGTC
TGTACAGGACAGAGAGCAGACGGTTACTGACAAAGCCTGCGCGGTAGTGATGTCGGGTAGTGTCTTCTGC
CTGAAAAATCTCAGTGGGCAAATCTGGATCAACCAGGCACCTGTTGCTGCCACCTCCGCGCTAATCCAGT
TGCGGCAGGGCGATGAAATTTTACTGGGATCACTGCTCCTGAAAGTTTTTCTGTCCGAAGGAAAACACAC
GGATTATGACGAACAGATGGCTGCGCCTGAAACGATTGTGACTAACCGTGATCGCCTGGTGGATATCCTG
CTGACGACAGAAGGCCAGCCTGAATATCCGGGAATGTCCCGCAAACATCAGATGGCAGATACGGTAGTTA
ACAGTTTCTCGACTGATCCTTTACAGGTACTCCAGACGGAGAGTCTGACCGTAGCGGGTTCCCTGTTCTC
CGATACGCCTCCGGGCAGGTCATCGTCCCTCTTATCCGGCACTGCGCGTAATAATGAGATTGATACCCCG
TTTATGGATTTGCCTCCGATATATGCCGAACCTCGGGATAAAGATACGCCTGTTGAGATGGCACAAAGGC
ATCTTGCCGTCACGCCATTATTACGTGGGCTGGGCTGTTCTCTGACCGTACATAACTCCAAAGAGGCCGA
TGATTTCCTTGAGGAAGTCGGGCGAACGTTGCAGGCAGCCATTAAAGGTCTGCTGGATCTGCAACAGCGG
CGTAACAGCCTGTCAGATAAACATCTGCGCCCGCTGGAGGATAACCCGTTGCGCCTGAACATGAGTTATG
ACTCGGCGCTGGATGTCATGTTTGCCGAAGGAAAAAGTCCTGTACACCTGGCTGCTCCCGCAGCTGTGGG
GGAAAGCCTGCGTAATATCCGCCATCACGATGATGCCAACCGGGCAGCGATTGTGGAGTCGCTGCGTGTG
TTGCTGGACGCATTTTCCCCTCAGAGTCTGATACGACGTTTTGTCCAGTACCGTCGAAGCCATGAGTTAC
GCCAGCCACTGGATGATGCCGGGGCATGGCAGATGTACTGCAACTACTACGATGAACTGGCGTCAGATCG
CCAGCAGGGGTTTGAGATGTTGTTTAACGAAGTCTACGCCCAGGTCTATGACCGGGTTCTTCGTGAAAAA
CAGCGGGAGCCAGAAGCATGA