SecReT6
Protein ID: 218549310
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1972
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2022786..2023823 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7LTS2
KEGG IDefe:EFER_1972
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.50E-83, Aligned region: 21..332
Protein Sequence: 345 a.a.     [Download]
>gi|218549310|ref|YP_002383101.1| hypothetical protein EFER_1972 [Escherichia fergusonii ATCC 35469]
MAGKDRSAHADIGQDTVFSDACSYNFFALMESLYRHTGHRSVVSLDTEPEDEIAHFVADASLVFPKSDVV
SLTKKENGQYAITVSFSGLHGSQSPLPGYYLDELALEVAQEEEGLAGFLDLFAHRWTQFLYHIWRKYRYY
VCFRNGGVDDFSRRMYALVGLGSESLRDQLAINHSKMLAYAGTLASPGRSPEVICSLISHCFDLPDVSLE
GWQLRQVDITPERQNRLGIRTARTGKKFIEKSVLGSNFTLGSRIPDRSGKFLLCINNLSRDRLLSFLPNG
LNFIPLTLFVAFILRDQLAWDLRLGFAPEQAGGMVLGRAQNSLLGWTSFIGQPEPESGVIINVRS
 
Nucleotide Sequence: 1038 bp     [Download]
>ref|NC_011740.1|:c2023823-2022786 hypothetical protein EFER_1972 [Escherichia fergusonii ATCC 35469]
ATGGCCGGAAAGGACAGGTCAGCACACGCTGATATAGGGCAGGACACCGTTTTTTCAGACGCTTGCAGCT
ATAACTTTTTTGCGCTGATGGAGTCCCTGTATCGCCATACCGGACACAGGTCAGTGGTTTCTCTGGATAC
GGAGCCGGAGGACGAAATTGCGCATTTTGTCGCTGATGCCAGTCTTGTCTTCCCTAAAAGTGATGTGGTG
AGCCTGACGAAAAAAGAGAACGGCCAGTATGCCATCACCGTTTCATTTTCAGGTCTGCACGGCAGTCAGT
CACCATTGCCCGGTTATTACCTGGATGAACTGGCGCTGGAGGTTGCTCAGGAAGAAGAGGGGCTGGCAGG
TTTTCTTGATCTGTTTGCTCATCGCTGGACGCAATTTCTGTATCACATCTGGCGAAAATACCGTTATTAC
GTCTGTTTTCGTAATGGCGGTGTGGATGATTTTTCCCGGCGTATGTATGCACTGGTCGGGCTGGGAAGCG
AATCTCTCCGCGATCAGCTTGCGATTAACCACAGCAAAATGCTGGCCTATGCCGGAACGCTGGCAAGTCC
GGGGCGCTCACCTGAAGTCATCTGTAGTTTGATTTCTCACTGCTTCGATTTACCTGATGTCTCCCTTGAA
GGATGGCAGTTACGCCAGGTGGATATTACGCCAGAAAGGCAAAACCGTTTGGGAATACGGACCGCCCGCA
CCGGTAAAAAATTTATTGAGAAGTCGGTGTTGGGAAGCAATTTTACGCTTGGTAGCCGTATACCGGATCG
CAGCGGTAAGTTTTTGTTGTGTATCAATAATCTTTCCCGAGATCGTCTGTTGTCATTCCTGCCAAATGGC
CTGAATTTTATACCGCTGACCCTGTTTGTGGCGTTTATCCTGCGGGATCAACTGGCCTGGGATTTGCGTC
TTGGTTTTGCTCCGGAGCAGGCGGGGGGCATGGTCCTGGGGCGGGCACAAAACTCCCTGTTGGGATGGAC
CAGTTTTATCGGGCAGCCGGAGCCAGAATCCGGCGTCATTATCAATGTCAGGTCGTAA