SecReT6
Protein ID: 218549311
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1973
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2023787..2025619 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7LTS3
KEGG IDefe:EFER_1973
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.90E-188, Aligned region: 5..610
Protein Sequence: 610 a.a.     [Download]
>gi|218549311|ref|YP_002383102.1| hypothetical protein EFER_1973 [Escherichia fergusonii ATCC 35469]
MLFEERYYRKELDYLRQAGKLLAKDKPHLARFLADKGADPDVERLLEGFALLAGNLRAKIDDEFPEVTHS
LINMLWPNYLRPTPSMTIIEYEPDTRKIDTPVLIARGAQMMNGEGSYPFAPGNDDDSTLQPPCIFTLCRD
IWLLPVTVENITLHNNQQQGCIEIAFFAENGINPGRTDFNKLRFWLGDEDEYTRNQLYLWLSEYLADAEF
VTEGDSVRLPDFALEQVGFSKQDALLPWPGNVYSGYRILQEYLCFKDAFFFFNVQGIHSLPVTDKDVNRF
TLRLHFSRPLPLDTRIRKTSLRLYCAPAINLFSCESEPIAIVDSREEYPLRASYMHSECYDIFSVDSVES
SRRSENKYGKARQPVSSRRYPAFESFQHQIEFARNRETIYYRIRTESSLFHSGFDHSLSFVLADNTPPAS
WNTQEVVSVSLTCTNRNLPEKLHSGDISLSAEKNAAVASFRNITRPTPSLYPVLDGRLHWQLLSSMSMNY
LSLLNKDALKQVLCIYDLPGIHNPQTAHLSRQKLDAIERIDTRPVDYLFKGVPVRGLTSTLYIRAEPFAC
EGEIYLLGTVLSHFFSLYASVNSFHELKIMNMDNQECYEWPERTGQHTLI
 
Nucleotide Sequence: 1833 bp     [Download]
>ref|NC_011740.1|:c2025619-2023787 hypothetical protein EFER_1973 [Escherichia fergusonii ATCC 35469]
ATGTTATTTGAGGAACGGTATTACCGAAAAGAGCTGGATTACCTGCGTCAGGCCGGGAAACTGTTGGCAA
AGGATAAGCCTCATCTGGCGCGCTTTCTGGCCGATAAAGGAGCCGATCCTGATGTAGAACGCTTGCTGGA
AGGATTTGCCCTGCTCGCCGGCAATCTGCGCGCCAAAATTGATGATGAATTTCCCGAAGTCACTCACAGC
CTGATTAACATGTTGTGGCCGAATTATTTACGGCCCACACCCAGCATGACCATCATTGAATATGAACCAG
ATACGCGGAAGATTGACACCCCGGTGTTGATTGCCCGTGGTGCACAGATGATGAACGGGGAGGGAAGTTA
TCCATTCGCTCCCGGAAATGATGACGACAGTACTCTTCAGCCTCCGTGTATCTTCACGCTTTGTCGGGAT
ATCTGGCTGCTGCCCGTCACGGTGGAAAATATCACCCTGCATAATAATCAGCAGCAGGGATGTATTGAGA
TTGCTTTTTTTGCTGAAAACGGAATCAATCCGGGGCGAACTGATTTCAACAAGCTGCGTTTCTGGCTGGG
CGATGAAGATGAATACACCCGCAACCAGCTCTATCTCTGGTTGAGTGAATATCTGGCGGATGCTGAATTT
GTTACAGAAGGCGACTCCGTTCGTTTACCAGACTTCGCACTGGAGCAGGTTGGGTTCAGTAAACAGGATG
CGCTTTTACCCTGGCCCGGTAATGTCTACAGTGGTTACCGTATATTGCAGGAATACCTGTGTTTTAAGGA
CGCTTTTTTCTTCTTTAATGTGCAGGGAATTCACTCGCTGCCTGTTACTGATAAGGATGTGAACAGGTTT
ACCCTTCGACTGCATTTCTCGCGTCCTTTGCCACTGGACACCCGTATCCGAAAAACATCATTGCGGTTGT
ATTGTGCACCGGCCATTAATCTGTTTTCCTGTGAAAGTGAACCCATTGCTATCGTAGACTCCCGTGAAGA
GTACCCTCTGCGGGCGAGTTATATGCATAGCGAGTGTTATGACATTTTTTCTGTTGATAGCGTTGAAAGC
TCCCGGCGGTCAGAAAACAAATACGGAAAAGCGCGGCAGCCAGTCTCTTCACGCAGATACCCTGCGTTTG
AAAGTTTTCAGCACCAGATCGAGTTTGCCCGTAACCGGGAAACCATTTATTACCGGATCAGAACGGAATC
GTCGCTTTTTCACTCCGGGTTTGATCATTCGCTATCTTTTGTTCTTGCTGATAACACTCCGCCAGCCTCA
TGGAATACGCAGGAGGTTGTTTCGGTGTCGTTAACCTGTACAAACCGTAATCTTCCTGAAAAATTACATT
CTGGCGATATTTCCCTCTCGGCAGAGAAAAATGCTGCGGTGGCTTCATTTCGTAATATCACTCGTCCGAC
GCCATCGCTCTACCCTGTTCTGGACGGGCGTCTGCACTGGCAGCTTTTGTCCAGTATGAGTATGAATTAC
CTTTCCCTGTTGAACAAAGATGCGCTTAAACAGGTGCTGTGCATTTATGACTTGCCCGGTATCCACAATC
CTCAGACAGCGCATCTCTCCCGGCAAAAACTGGATGCCATCGAACGGATTGACACCCGCCCGGTTGACTA
CCTGTTTAAAGGTGTTCCCGTACGCGGTTTGACCTCCACCCTGTATATCCGCGCAGAACCGTTTGCCTGT
GAAGGGGAGATTTATCTACTGGGTACGGTGCTGTCTCATTTCTTTTCGTTGTACGCCAGCGTGAACAGTT
TCCACGAATTAAAAATAATGAATATGGATAACCAGGAGTGCTATGAATGGCCGGAAAGGACAGGTCAGCA
CACGCTGATATAG