SecReT6
Protein ID: 218549312
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1974
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2025625..2026062 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7LTS4
KEGG IDefe:EFER_1974
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-17, Aligned region: 35..125
Protein Sequence: 145 a.a.     [Download]
>gi|218549312|ref|YP_002383103.1| hypothetical protein EFER_1974 [Escherichia fergusonii ATCC 35469]
MKYQDRGLRASGSLFERVREAARSPVPRPVNAGMLQLSIRHNLHNILNTRPGSCRASPLLGVLDFNDAAT
TSQGFNAAIERAVKECIEKHEPRITHADVYMEKSDTGNGPLDLRLHITATVEFQNVRDVLEFSLSLDNKQ
HYLVD
 
Nucleotide Sequence: 438 bp     [Download]
>ref|NC_011740.1|:c2026062-2025625 hypothetical protein EFER_1974 [Escherichia fergusonii ATCC 35469]
ATGAAGTATCAGGACCGGGGATTACGGGCTTCGGGAAGTTTATTTGAACGTGTACGTGAAGCGGCCCGAT
CACCGGTTCCTCGTCCTGTTAATGCCGGGATGCTTCAGTTATCCATCCGACATAATCTGCATAATATTTT
GAATACCCGGCCTGGTAGCTGCCGGGCTTCTCCTTTGCTGGGCGTACTCGATTTTAATGACGCCGCCACA
ACATCCCAGGGATTTAATGCTGCTATTGAACGGGCGGTAAAAGAGTGCATCGAAAAGCACGAACCCCGGA
TAACACATGCAGATGTTTATATGGAAAAAAGTGATACCGGAAACGGACCGTTGGATCTGCGCCTTCATAT
TACGGCAACGGTGGAATTCCAGAACGTCAGGGATGTTCTGGAGTTCAGCTTATCCCTTGATAATAAACAA
CATTACCTGGTGGACTGA