SecReT6
Protein ID: 218549314
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1976
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2027561..2028160 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7LTS6
KEGG IDefe:EFER_1976
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-52, Aligned region: 42..194
Protein Sequence: 199 a.a.     [Download]
>gi|218549314|ref|YP_002383105.1| hypothetical protein EFER_1976 [Escherichia fergusonii ATCC 35469]
MILIFIATGAALPVFLFGTDHAVFRATTRWTNHMSSQKYGGSIAPRERINIHYVPRTNDQAAEVELPLNI
VVVGDTKGALDETPIDERQAVSINKNNFRSVMAEVGIKTTVTVADKLSEKPDGEMSVTLDIKSLDDFSPD
NIARQVPEMKKILELREALVALRGPMGNVPAFRAQLQALLDNEETREQLLRELDIIDQK
 
Nucleotide Sequence: 600 bp     [Download]
>ref|NC_011740.1|:c2028160-2027561 hypothetical protein EFER_1976 [Escherichia fergusonii ATCC 35469]
GTGATTCTTATTTTTATCGCCACTGGAGCGGCATTGCCGGTATTTTTGTTTGGTACGGATCATGCTGTGT
TCAGGGCCACAACAAGATGGACTAATCATATGAGCAGCCAAAAATACGGCGGCAGTATTGCGCCTCGCGA
GAGAATTAATATCCACTATGTGCCACGCACTAATGATCAGGCCGCTGAAGTTGAGCTCCCACTTAATATT
GTGGTGGTTGGCGACACAAAAGGCGCTCTGGATGAAACACCTATTGATGAACGCCAGGCGGTGTCCATTA
ATAAAAACAATTTCCGTTCTGTAATGGCAGAAGTCGGGATCAAAACCACGGTGACGGTTGCTGACAAGCT
CAGTGAAAAACCTGACGGCGAAATGAGTGTCACCCTGGACATTAAATCACTGGATGATTTTTCACCAGAC
AATATCGCAAGGCAAGTGCCCGAAATGAAGAAAATACTGGAACTGCGTGAGGCTCTCGTTGCTTTACGTG
GACCAATGGGGAATGTCCCTGCATTCCGCGCCCAGCTTCAGGCTTTGCTGGATAACGAAGAAACCCGTGA
GCAGCTCCTCCGGGAACTGGATATCATCGATCAGAAATAA