SecReT6
Protein ID: 218549315
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1977
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2028690..2029271 [+]
Producthypothetical protein
NoteTssD
UniProt IDB7LTS7
KEGG IDefe:EFER_1977
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-34, Aligned region: 27..176
DCAF15_WD40 [PF14939], Evalue: 0.0067, Aligned region: 116..157
Protein Sequence: 193 a.a.     [Download]
>gi|218549315|ref|YP_002383106.1| hypothetical protein EFER_1977 [Escherichia fergusonii ATCC 35469]
MPKITGRQFILIVNTFTRNSQMPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVT
VPTDPQSGQPAGQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDST
IVDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 582 bp     [Download]
>ref|NC_011740.1|:2028690-2029271 hypothetical protein EFER_1977 [Escherichia fergusonii ATCC 35469]
TTGCCGAAAATAACCGGCAGGCAATTTATATTAATAGTCAACACCTTTACAAGGAATTCACAAATGCCAA
CTCCGTGTTACATCTCTATTACTGGTCAAACCCAGGGGAATATTACCGCAGGTGCTTTTACCGCTGATTC
CGTCGGTAATATCTATGTGCAGGGTCACGAAGACGAAATGCTGGTTCAGGAGTTCCTGCATAACGTCACC
GTCCCGACTGATCCGCAATCCGGTCAACCTGCGGGTCAGCGCGCCCACAAACCGTTCATCTTTACCGTGG
CGTTGAACAAAGCTGTTCCGCTGATGTACAACGCACTGGCCTCAGGCGAAATGCTACCAACCACAGAGTT
GCACTGGTGGCGTACCTCTGTTGAAGGTAAACAAGAGCATTATTTCACCACCCGTCTGACGGATTCGACG
ATTGTGGATATGAAACTTCATATGCCGCATTGCCAGGACCCGGCAAAACGCGAGTTCACCCAGTTGCTCG
AAGTGTCTCTTGCCTACCGTAAAATCGAGTGGGAACACGTCAAGTCTGGCACATCTGGGGCTGATGACTG
GCGCGCACCTTTGGAAGCATAA