SecReT6
Protein ID: 218549316
SecReT6 ID314
T6SS typei1
Gene symbol-
Locus tagEFER_1978
StrainEscherichia fergusonii ATCC 35469
Repliconchromosome [GenBank: NC_011740] [Browse all T6SS(s) in this replicon]
Location [Strand]2029481..2031427 [+]
Producthypothetical protein
NoteTssI
UniProt IDB7LTS8
KEGG IDefe:EFER_1978
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-60, Aligned region: 28..327
Phage_base_V [PF04717], Evalue: 1.60E-26, Aligned region: 365..457
T6SS_Vgr [PF13296], Evalue: 0.0056, Aligned region: 176..194
T6SS_Vgr [PF13296], Evalue: 0.0056, Aligned region: 470..511
Protein Sequence: 648 a.a.     [Download]
>gi|218549316|ref|YP_002383107.1| hypothetical protein EFER_1978 [Escherichia fergusonii ATCC 35469]
MPEGTRFTLEASGLPPDTFAVVTFHLSQSLSSLFTLDVTAVSHDPAIDFSAIIDEDVTLTIWQGDSPQRR
VKGLVTWCEQGDTGKHQTQYRMRIRPPFWRSSLRQNCRSYQNQDIRTILFTLLREMGVLYYDALFALPHP
AREFCVQFMETDFDFARRLMAEEGIYFFEEEDLQAATQKLIMADKAGYQQSALSLPYNPNGDVTPEYCIR
SFRRSTQIRPAKVVSRDYTFTAPNWRGQFERRGDNMPFQRPDYEIFDYPGRFKDEQHGAGFTRYQLEGLR
NNAECADGSSNSPQLWPGMRFTLSAHPRADLNVLWQVVESELHGEQPQAQVGHGGSGTTLVNDFTVIPGH
QTWRPVPEPKPLIDGPQTAVVTGPPGEEIFCDEHGRVRVKFTWDRYNAADQDSSCWVRVSQAWAGTGFGN
LAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQDNRSPGSLPGTKTQMAIRSKTYKGSGYNELMFEDRTGQE
LLSMHAQKDMSTVVLNHRVTTVGANHVESVTGVQTIDVQAGQAIKVHASHDQKVKAMHNTLVGENKVELV
AGKYLMNSASEVTIACGDAAITLTQDGNINWYCKNFNIYADGKGEITATDTVDINMDGAKPGKIGAHFGP
DDINNAVKAAFPPPAPEK
 
Nucleotide Sequence: 1947 bp     [Download]
>ref|NC_011740.1|:2029481-2031427 hypothetical protein EFER_1978 [Escherichia fergusonii ATCC 35469]
ATGCCAGAAGGAACGCGCTTTACCCTGGAGGCCAGCGGGCTTCCCCCCGACACCTTCGCCGTTGTCACCT
TCCACCTCTCCCAGTCCCTTTCCTCGTTGTTCACCCTCGACGTCACCGCCGTCAGTCACGACCCCGCCAT
CGATTTCTCCGCCATCATCGATGAGGACGTCACCCTGACTATCTGGCAGGGCGACTCCCCACAGCGACGG
GTAAAAGGACTGGTCACATGGTGCGAACAGGGCGATACCGGTAAACACCAGACTCAGTACCGCATGCGTA
TCCGCCCTCCTTTCTGGCGCTCATCCCTCCGCCAGAACTGCCGCAGCTACCAGAACCAGGACATCCGCAC
CATCCTCTTCACCCTGCTCAGAGAGATGGGCGTGCTTTATTACGATGCCCTCTTTGCACTCCCTCACCCC
GCCCGCGAGTTCTGCGTCCAGTTCATGGAAACCGACTTCGATTTCGCACGCCGCCTCATGGCCGAGGAAG
GGATTTACTTCTTTGAAGAGGAAGACCTTCAGGCCGCCACCCAGAAGCTCATCATGGCCGACAAAGCCGG
TTACCAGCAGTCCGCCCTGTCTCTGCCCTATAACCCCAACGGCGACGTCACCCCTGAATACTGTATCCGC
AGCTTCCGCCGCAGCACTCAGATCCGACCGGCTAAAGTGGTTTCCCGGGATTACACCTTTACCGCACCCA
ACTGGCGCGGGCAGTTTGAGCGACGCGGTGACAACATGCCTTTCCAGCGTCCCGACTACGAGATTTTCGA
CTATCCGGGGCGCTTCAAGGATGAACAGCACGGCGCGGGCTTTACCCGTTACCAGCTTGAAGGGCTGCGT
AATAACGCCGAGTGTGCTGACGGCTCTTCGAACTCCCCGCAACTGTGGCCGGGAATGCGCTTCACGCTGT
CAGCCCATCCGCGCGCGGACCTGAACGTTCTCTGGCAGGTGGTGGAAAGTGAGCTGCACGGCGAACAACC
CCAGGCGCAGGTCGGCCACGGCGGTTCCGGCACCACCCTGGTCAATGACTTTACCGTCATTCCCGGACAC
CAGACCTGGCGTCCTGTCCCTGAACCCAAACCACTGATTGACGGCCCGCAGACCGCCGTTGTCACCGGAC
CGCCGGGCGAGGAAATCTTCTGCGACGAACACGGGCGCGTGCGCGTGAAGTTCACCTGGGACCGCTACAA
CGCCGCTGACCAGGACAGCTCCTGCTGGGTGCGGGTGTCGCAGGCATGGGCCGGAACCGGCTTCGGCAAC
CTCGCCATCCCCCGCGTGGGCCAGGAGGTCATCGTGGACTTCCTCAACGGCGACCCCGACCAGCCCATCA
TCATGGGCCGCACCTACCACCAGGATAACCGGTCGCCGGGCAGCCTGCCGGGAACGAAGACACAGATGGC
GATACGCTCAAAAACCTACAAGGGGAGCGGTTATAACGAACTCATGTTTGAGGACAGGACCGGGCAGGAG
CTGCTCTCCATGCATGCACAGAAGGATATGTCAACCGTGGTGCTTAATCACCGGGTGACGACCGTGGGAG
CCAACCATGTGGAATCGGTCACTGGCGTTCAGACCATCGATGTCCAGGCAGGCCAGGCAATCAAAGTCCA
TGCCAGCCACGATCAGAAAGTGAAGGCGATGCACAACACGCTGGTCGGTGAAAATAAAGTCGAGCTGGTC
GCCGGGAAATACCTGATGAACAGCGCGTCAGAAGTCACCATCGCCTGTGGCGATGCCGCCATTACGCTGA
CCCAGGACGGCAACATCAACTGGTACTGCAAAAACTTCAATATCTATGCGGACGGAAAAGGTGAGATCAC
CGCCACCGATACCGTGGATATCAACATGGACGGGGCAAAACCCGGAAAGATTGGCGCACACTTTGGCCCC
GACGATATCAATAACGCCGTCAAAGCCGCATTTCCCCCGCCAGCCCCTGAGAAATAA