SecReT6
Protein ID: 218552794
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0228
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]239789..241231 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7M218
KEGG IDecr:ECIAI1_0228
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.40E-44, Aligned region: 322..466
ImpA-rel_N [PF06812], Evalue: 1.10E-20, Aligned region: 71..130
ImpA-rel_N [PF06812], Evalue: 1.10E-20, Aligned region: 278..294
Protein Sequence: 480 a.a.     [Download]
>gi|218552794|ref|YP_002385707.1| hypothetical protein ECIAI1_0228 [Escherichia coli IAI1]
MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPEL
NWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLD
WFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLGPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVINQGSTVRGFIAGIACS
VAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADS
RWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGL
GQETPVESLLTQYHDARAQKQNTDALEKQINERLEGVLSRWLLLKNNVMPEAATGTTAEK
 
Nucleotide Sequence: 1443 bp     [Download]
>ref|NC_011741.1|:c241231-239789 hypothetical protein ECIAI1_0228 [Escherichia coli IAI1]
GTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACAC
ACTGTACTGAGGAGGCAGGGATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCG
CGGGCTGCCGGAATTCAGCGCCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTG
AACTGGAAACTGGTGGAGTCGCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCA
CCTACTATACGCTTGCCCGGACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGC
GGCAATGGTAAGCCACGACTGGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGAC
TGGTTTAACTCCCGAACCGGCAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGA
TCTACCGCACAGAGCGGGCATTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCC
GCGCGTGGAGAATCTGCTCTATTTTATGCAGAACACGCGTAAACGGCTTGGACCCCAGCTGAAGAGTAAC
ACTGAGAACGCCGCACAGACCACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACAC
CAGAAGCGGTAGTGCCTCCCCTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTTCGCAGTCTGACAGAGAA
TCCCCCACAGGCCAGTGTGATAAATCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCA
GTGGCTGTCGCCTCAGCATTGTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACG
ACACCGCTCAGGGCGCAGCAACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCA
ACAACTTCTTGATACCTCCCCGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGT
CGCTGGCCGGAAAGCCTGCAACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCAC
AGAGTAGCCCGCAGTTGCGTGGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGAT
GCAGCGCGAGAAAGAGGGACTAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTG
GGGCAGGAAACACCCGTTGAGTCTCTGTTGACGCAGTACCATGATGCCCGTGCGCAGAAGCAGAATACAG
ATGCGCTGGAAAAACAAATTAATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAA
CGTCATGCCAGAGGCGGCAACCGGTACCACGGCCGAAAAATAA