SecReT6
Protein ID: 218552796
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0230
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]244695..246173 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7M220
KEGG IDecr:ECIAI1_0230
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.70E-09, Aligned region: 76..133
ImpA-rel_N [PF06812], Evalue: 6.70E-09, Aligned region: 174..206
Protein Sequence: 492 a.a.     [Download]
>gi|218552796|ref|YP_002385709.1| hypothetical protein ECIAI1_0230 [Escherichia coli IAI1]
MTGWQGRLLPCAMPATGRENKNMAMDLRDPNVWISHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSL
AHSQLDIPELQRRGLVILASESKDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRF
ASQVIKRFETGIEVFSQNAATAQRDALSGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPVP
TPAASGSSPQTTATSESGVTQPSAPAPQIVIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQ
NITSTPQAESDGRTPLAAVSADMVADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQ
VADAIRDEVIRFLERLPQLTGLLFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLE
AALRYLDMLPEGDPRDQFHRQYLAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTA
EQ
 
Nucleotide Sequence: 1479 bp     [Download]
>ref|NC_011741.1|:c246173-244695 hypothetical protein ECIAI1_0230 [Escherichia coli IAI1]
TTGACGGGCTGGCAAGGGCGATTGCTCCCCTGCGCGATGCCTGCCACTGGGCGGGAGAATAAAAATATGG
CAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAACTGGC
ATCGGCGCTGAAAGATGACAACCCGAACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGATCGCTG
GCCCACAGTCAACTGGATATCCCGGAACTCCAGCGCCGGGGGCTGGTCATTCTGGCTTCGGAGAGTAAGG
ATTTTCGTCTGCTGGCGCATCTGCTGAGAACCCTGCAACACGCCGGTGATCCTCATCTCGCATTGCGCCT
GCTGGCGCTGTATGTGGAGCATTACTGGGCGGTGGCTGCGCCGCAGAATATGGCGCATAAAAAACGCTTT
GCCAGCCAGGTCATTAAACGCTTTGAAACAGGTATTGAAGTTTTTTCACAGAACGCCGCCACAGCGCAGC
GCGATGCGCTGTCAGGGGAACTGGCAAAACTGGCGCAATGCTGGCAGTCACATAACGCCCCGGAACTGGC
ACAGGCTACTGATGATCTTTTTGCCCTGTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCTGTCCCC
ACTCCGGCGGCCTCCGGTAGTTCACCACAGACCACCGCCACGTCTGAAAGCGGCGTGACGCAACCCAGTG
CTCCGGCTCCCCAAATCGTCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAGTGGC
GGCCATTTTATGTGAACGCCAGCCGGATTCACCGCAGGGCTACCGTCTGCGCCGCCATGCGCTTTGGCAG
AACATCACCAGTACGCCCCAGGCGGAAAGCGATGGCCGTACTCCACTGGCTGCGGTCTCCGCCGATATGG
TGGCAGATTACCATGCTCAGCTCGGTAGTGCCGATATGGCGCTGTGGCAGCAGGTGGAGAAAAGCGTACT
GCTGGCTCCTTACTGGCTGGATGGTCACTGCCTTTCTGCACAGACGGCGCTGCGTCTGGGTTACAAACAG
GTGGCAGACGCCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTGCTGT
TTAATGACCACACACCGTTTATCAGTGAGCAGACGAAACAATGGCTGGCAGCTTCGCCCGACGCCAAAGT
TGCACCGGTTGCGCAAATCGGTGAGGAATCGAAGGCAGCCAGAGCCTGTTTTGCTGAGCAGGGTCTGGAG
GCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTACCTTG
CCGCACAGTTGACGGAAGAGGCGGGGCTGGTACAGCTTGCGCAGCAGCAGTACCGGATGTTGTTCAGGAT
GGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATTCACGGCA
GAACAATAA