SecReT6
Protein ID: 218552798
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0232
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]246852..249791 [-]
Productputative ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity
NoteTssH
UniProt IDB7M222
KEGG IDecr:ECIAI1_0232
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-38, Aligned region: 262..280
AAA_2 [PF07724], Evalue: 1.60E-38, Aligned region: 702..863
AAA [PF00004], Evalue: 9.00E-17, Aligned region: 261..372
AAA [PF00004], Evalue: 9.00E-17, Aligned region: 708..825
AAA [PF00004], Evalue: 9.00E-17, Aligned region: 837..899
AAA_5 [PF07728], Evalue: 9.70E-14, Aligned region: 260..280
AAA_5 [PF07728], Evalue: 9.70E-14, Aligned region: 707..827
ClpB_D2-small [PF10431], Evalue: 1.40E-12, Aligned region: 869..946
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 53..85
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 237..277
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 301..338
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 460..537
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 678..748
AAA_16 [PF13191], Evalue: 5.90E-11, Aligned region: 773..801
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 259..345
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 485..520
AAA_22 [PF13401], Evalue: 2.10E-07, Aligned region: 706..741
AAA_25 [PF13481], Evalue: 7.20E-05, Aligned region: 260..284
AAA_25 [PF13481], Evalue: 7.20E-05, Aligned region: 494..525
AAA_25 [PF13481], Evalue: 7.20E-05, Aligned region: 702..736
AAA_25 [PF13481], Evalue: 7.20E-05, Aligned region: 835..899
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 260..287
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 321..383
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 708..736
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 914..937
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 204..219
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 252..278
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 705..732
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 260..359
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 707..797
AAA_19 [PF13245], Evalue: 0.00025, Aligned region: 257..281
AAA_19 [PF13245], Evalue: 0.00025, Aligned region: 701..729
DUF258 [PF03193], Evalue: 0.00037, Aligned region: 237..277
DUF258 [PF03193], Evalue: 0.00037, Aligned region: 708..726
Zeta_toxin [PF06414], Evalue: 0.0038, Aligned region: 12..73
Zeta_toxin [PF06414], Evalue: 0.0038, Aligned region: 260..279
Zeta_toxin [PF06414], Evalue: 0.0038, Aligned region: 706..747
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 261..280
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 708..743
Protein Sequence: 979 a.a.     [Download]
>gi|218552798|ref|YP_002385711.1| putative ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity [Escherichia coli IAI1]
MWWRCRAGVVLPVLSVAAGQPDAGHPAPAKQITSIRTFMIQIDLPTLVKRLNLFSRQALEMAASECMSQQ
AAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLL
ASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPDADGKGAGTM
TDASDTLLARYAKNMTADARNGRLDPVLCRDHEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLALRI
VAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLMAEVISSPVPVILFIDEAHTLIGAGNQQGGL
DISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEPNAAEATIILRGLSAVYEQSHGV
LIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARVAINLSSPPKQISALTTLSHQQEAEIRQLEREL
RIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADTVEDTQ
PESESESESESESESESESESESESEQDNTGAEPADEAGSEQPEETAETVSPVQRLAHLTAELDALHNDR
LLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLTARADLRRP
GRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTE
AIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIVEHADDPET
MQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAEVIIEPEVTDEIMSR
VTRAENGARMLESVIDGNMLPPLSLLLLQKMAANTAVARIRLSAVDGAFTADVEDAQNDESVTKDETVL
 
Nucleotide Sequence: 2940 bp     [Download]
>ref|NC_011741.1|:c249791-246852 putative ATP-dependent Clp proteinase Aec27 ATP-binding chain, with chaperone activity [Escherichia coli IAI1]
TTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATCTGTTGCGGCTGGACAGCCAGACGCAG
GACATCCTGCACCAGCTAAACAAATTACTTCGATAAGGACGTTTATGATCCAGATTGATCTTCCCACGCT
GGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGGCCGCCTCTGAATGTATGAGTCAGCAG
GCAGCGGAAATTACCGTCAGCCATGTGCTCATTCAGATGCTCGCCATGCCACGCAGTGACCTGCGGGTTA
TTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCGCTGACGGTAGAGAACTACACAACCGC
CCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTGAGTGGCTTAAAGAGGGCTGGCTGCTG
GCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTTGCTGCTGGCCCTGCTGCATTCGCCGC
TGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATTAACCGTGACCGTCTGCAACAGGACTT
TGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATGCAGACGGTAAAGGCGCAGGCACAATG
ACGGACGCCTCTGACACCCTGCTTGCCCGCTATGCCAAAAACATGACCGCAGACGCCCGTAACGGCAGGC
TTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATCGACATTCTCTGCCGCCGCCGTAAAAA
CAACCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCACTGATTGAAGGGCTGGCGCTGCGCATC
GTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCATGACCCTTGACCTGGGCGCATTGCAGG
CCGGGGCGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGGCTGATGGCGGAGGTCATTTCCTCCCC
GGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTGGCGCGGGCAACCAGCAGGGCGGGCTG
GATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCTGAAAACCATCGCCGCCACCACCTGGA
GCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGCCGCTTCCAGTTGGTGAAGGTCAGCGA
ACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGGCGGTCTATGAACAGTCTCACGGCGTG
CTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGAGCGTTATCTCTCCGGGCGTCAGTTAC
CGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTGGCCATCAACCTGTCGTCGCCGCCGAA
GCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGGAAATTCGCCAGCTTGAGCGCGAGCTT
CGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCTGGTGCAGTATGATGAAACGCTGACGG
CGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTGGTCCGGGAGATTATTGCGCTGCGCCA
GCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGGACGCAGATACCGTGGAGGATACGCAG
CCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAG
AGTCAGAGCAGGATAATACCGGTGCCGAACCGGCTGATGAAGCTGGCAGCGAACAGCCGGAAGAGACCGC
TGAAACAGTTTCCCCGGTACAACGTCTGGCACATCTCACTGCCGAACTGGACGCCCTGCATAACGACCGG
TTGCTGGTTTCCCCGCACGTCGATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGC
TTAACCGCCTGTCGCAGAATGAAATGTCGGTCATCACCGACCTGCCAAAATGGCTCGGCGACACCATCAA
AGGCCAGGACCTGGCGATTGCCAGCCTGCACAAACACCTGCTGACCGCACGCGCCGACCTGCGCCGTCCG
GGACGCCCGCTGGGCGCGTTCCTGCTGGCTGGCCCCAGCGGCGTGGGTAAAACTGAAACCGTCCTGCAAC
TGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCTGACCACCATCAATATGTCCGAGTTCCAGGAGAAACA
TACCGTCTCGCGACTGATTGGCTCCCCTCCGGGCTACGTTGGCTACGGTGAAGGCGGCGTACTGACCGAA
GCGATTCGCCAGAAACCCTACTCGGTAGTACTGCTCGATGAAGTGGAAAAAGCGCACCCGGATGTGCTCA
ACCTGTTCTACCAGGCGTTCGATAAGGGCGAAATGGCAGACGGTGAAGGCCGCCTGATTGACTGCAAAAA
TATCGTCTTCTTCCTGACGTCCAACCTCGGCTACCAGGTAATAGTCGAGCATGCCGATGACCCGGAAACC
ATGCAGGAAGTACTGTATCCGGTGCTGGCCGACTTCTTCAAACCTGCCCTGCTGGCGCGTATGGAAGTGG
TGCCGTACCTGCCGCTGTCGAAAGAGACGCTCGCCACCATCATTGCCGGGAAACTGGCCCGCCTGGATAA
CGTGCTGCGCAGCCGCTTTGGCGCGGAGGTGATTATAGAACCGGAAGTGACGGACGAAATCATGAGCCGC
GTCACCCGCGCGGAAAACGGCGCGAGGATGCTGGAATCGGTCATCGACGGCAATATGCTGCCGCCGCTCT
CCCTGCTGCTGTTGCAGAAAATGGCGGCGAATACGGCGGTTGCCCGGATTCGGTTGTCGGCAGTGGACGG
CGCATTTACGGCAGACGTGGAAGATGCTCAGAACGACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA