SecReT6
Protein ID: 218552800
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0234
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]250452..251783 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7M224
KEGG IDecr:ECIAI1_0234
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.70E-148, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|218552800|ref|YP_002385713.1| hypothetical protein ECIAI1_0234 [Escherichia coli IAI1]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNDLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLHPQNFPDERSRNIYLALPVASDVRNEISDGRRTGRYRLNYADVRDLHSEEGD
ARTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATFVLAVAA
NVPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>ref|NC_011741.1|:c251783-250452 hypothetical protein ECIAI1_0234 [Escherichia coli IAI1]
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGCCCACACCATTTCCAGCAAC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATGATTTATCCTGGGGATTTAC
CGAACTCACCCTCAACAATGAACTGCTGGCGCAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCCGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGCACCCGCAAAATTTTC
CGGACGAAAGAAGCCGCAATATCTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGACGGCGAACCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATTTGCATTCAGAAGAAGGTGAC
GCGCGAACATTGACGCTGGGTCAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGCGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGCGATCGCCATGCCGATGGCTCCCTGACGTTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGTATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTACTTAACCGTAACCAGACCCGGTTTACCCATCGCGCCCGCCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCTGGGTTGCTGGGTGAACTGATGACCTTTACCGAGCCGTCG
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGATCTGACCAAAACATTTAAAACACTGTTACCGG
AAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCGGTCAATCTGCCGCTGCATCTGCGTGACGG
TATCTGGCAGGCCGATATCCATGACACAGAACTGCTGCAATCTGCCACCTTTGTGCTGGCCGTGGCGGCA
AACGTGCCGGTCGATCAGATCCAGCGTCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATCCCCGGTATTCCATTGCGTGCCCTTATGGTGGCTCCCCGCCAGCTTCC
TTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGTGGCCAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTTTCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA