SecReT6
Protein ID: 218552802
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0236
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]252307..253608 [-]
Producthypothetical protein
NoteFha
UniProt IDB7M226
KEGG IDecr:ECIAI1_0236
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 433 a.a.     [Download]
>gi|218552802|ref|YP_002385715.1| hypothetical protein ECIAI1_0236 [Escherichia coli IAI1]
MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHGPECHWSVQDRQQSIPAQAFTVILHD
GTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDML
TDTLLSTEGAPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGG
INTPFMDLPPIYASPGDRNDDVSAAEMAQRHLAVTPLLRGLGGSLTMSNSDDADDFLEEAGRTLQAAIKG
LLDLQQQRNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAA
IVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVY
DRVLREKQREPEA
 
Nucleotide Sequence: 1302 bp     [Download]
>ref|NC_011741.1|:c253608-252307 hypothetical protein ECIAI1_0236 [Escherichia coli IAI1]
ATGATAATCACGGAGCAGAATATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCA
GTGAGCTGGAAAGCGGGCGGGCGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGGCCCCGA
ATGCCACTGGTCGGTACAGGATCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGAT
GGCACATTTTGTCTGCGCCCGCAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAG
ACCTAATACAGTTGCGCCAGGGCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCG
GGGAGATATTCCCCATTACGATGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTC
ACGGATACCCTGCTATCAACGGAGGGTGCGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAG
ACACCGTGGTAAACGGTTTTTCTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGG
CGATCCGCTTTCAGGCATTGCGGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGG
ATCAATACTCCGTTTATGGATCTGCCGCCCATTTATGCCAGCCCCGGCGATCGTAATGACGACGTCTCTG
CGGCAGAAATGGCGCAACGCCACCTTGCGGTCACCCCCTTACTTCGCGGTCTTGGCGGCTCGCTTACCAT
GAGCAATTCCGACGATGCGGATGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGT
CTGCTCGATTTGCAGCAGCAGCGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGC
TGCGCCTGAACATGGATTACGCCACCGCGCTCGACGTAATGTTTGCCGAAGGTAAAAGCCCGGTACATCT
GGCGGCTCCCGCCGCCGTCAGTGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCAGCA
ATTGTGGAGTCGCTTCGTGTCCTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGT
ACCGCCGCAGCCATGAACTGCGCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTA
CGAAGAACTGGCCTCCGATCGCCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTAT
GACCGGGTGCTTCGTGAAAAACAGCGGGAGCCGGAAGCATGA