SecReT6
Protein ID: 218552803
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0237
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]253612..254700 [-]
Producthypothetical protein
NoteTssG
UniProt IDB7M227
KEGG IDecr:ECIAI1_0237
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-93, Aligned region: 35..349
Protein Sequence: 362 a.a.     [Download]
>gi|218552803|ref|YP_002385716.1| hypothetical protein ECIAI1_0237 [Escherichia coli IAI1]
MEMDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAELLHRLAKGEKGTPELSLRDDPAQE
TLRFSADASLAFPCSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMF
SHRLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPE
IICGLVSHCFDLSEVTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQL
SITSLTRKQFLSFLPSGENFLPLTMFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTP
EERPSVTIRVRS
 
Nucleotide Sequence: 1089 bp     [Download]
>ref|NC_011741.1|:c254700-253612 hypothetical protein ECIAI1_0237 [Escherichia coli IAI1]
ATGGAAATGGACGGAAAGAACCGGGCAGCATCCTCTTATCTGAGTCCGGGAAATCCCCCGGCAGATAAAG
AGCAGAATGATCCGCTGGCACAGGTTTTCCATAATGCCTGCTCTTACAATTTTTTTGCGATGGCGGAGCT
GTTGCACCGCCTGGCAAAGGGTGAAAAGGGGACGCCAGAATTATCCCTGCGCGACGATCCGGCACAGGAA
ACCCTGCGTTTCAGCGCCGATGCCAGCCTTGCCTTCCCGTGCAGTGATATCAGTGCGCTGAAACGGGATA
CGTCAGGGGCATTCAGGATGACCACCACCTTTATGGGGTTACAGGGGAGCCAGTCGCCTCTCCCCGGTTA
TTACCTCGATCACCTGGCCTGGAAAGCGGTACATGAACAAAGTCCGGTAGGTGATTTTCTGGATATGTTC
AGCCACCGCCTGACCCAGTTTGTCTGGCATATCTGGCGTAAGTACCGCTATCACATCAGTTTTCGTAACG
GCGGTGTGGATGCGTTCTCGCAGCGCATGTACTCCCTTGTCGGGCTGGGCCACCGCCAGCTTCGCGATAA
GCTGGCGATTAATCACAGCAAAATGCTGGCGTATTCCGGGATCCTGGCAAATCCGGGACGATCCCCGGAA
ATTATCTGTGGCCTGGTGTCCCACTGCTTTGATTTGTCAGAAGTGACGCTGCAAAACTGGCAACGTCGCA
AGGTGGATATTGAACCGGATCAGCAAAATAGTCTGGGGAGCTATTCTCTTAAAAATGGCGAAAAACTGGC
GGGAAGATCGGTACTGGGCAACTTTGTTCTGGGTACACGAGTGCCCGATCTCAGCGGAAAATTCCAGCTC
AGTATTACCAGCCTGACCCGAAAACAGTTCCTCTCTTTTCTGCCGTCCGGCGAAAACTTCCTGCCACTGA
CGATGTTCGTGTCCTTCATCCTGCGCGATCAGCTTGCCTGGGACTTACATCTGGGGCTGGCGCCGGAGCA
GGTGGGCGCAATGCGCCTGGGCGATAACAAAAGTGCGCTGCTGGGCTGGACCAGCTTCCTCGGCACACCG
GAAGAACGACCCTCAGTCACCATCAGGGTACGGTCGTAA