SecReT6
Protein ID: 218552805
SecReT6 ID315
T6SS typei1
Gene symbol-
Locus tagECIAI1_0239
StrainEscherichia coli IAI1
Repliconchromosome [GenBank: NC_011741] [Browse all T6SS(s) in this replicon]
Location [Strand]256512..256925 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7M229
KEGG IDecr:ECIAI1_0239
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.30E-17, Aligned region: 30..118
Protein Sequence: 137 a.a.     [Download]
>gi|218552805|ref|YP_002385718.1| hypothetical protein ECIAI1_0239 [Escherichia coli IAI1]
MIPDRERTTGSLFERMEASPARNWQGSSIHALRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSLAIAQCIERYEPRISHAEVQAVVSSATSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>ref|NC_011741.1|:c256925-256512 hypothetical protein ECIAI1_0239 [Escherichia coli IAI1]
ATGATACCGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCACCGGCCAGAAACT
GGCAGGGAAGCAGTATTCATGCGCTCAGGCAGTCCATTCGCCAGAACCTGCGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAACTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCAATGAGTCTGGCCATCGCGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CTGTGGTTTCATCCGCCACCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACACATGAAGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTATCGGGTGGACTGA