SecReT6
Protein ID: 218557154
SecReT6 ID316
T6SS typei1
Gene symbol-
Locus tagECS88_0233
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]243925..245424 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7MC48
KEGG IDecz:ECS88_0233
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.80E-44, Aligned region: 138..203
DUF3702 [PF12486], Evalue: 3.80E-44, Aligned region: 305..318
DUF3702 [PF12486], Evalue: 3.80E-44, Aligned region: 335..481
ImpA-rel_N [PF06812], Evalue: 8.50E-21, Aligned region: 88..148
Protein Sequence: 499 a.a.     [Download]
>gi|218557154|ref|YP_002390067.1| hypothetical protein ECS88_0233 [Escherichia coli S88]
MTPLTCALTWTAAQWFTRCMWIPKITRSPAVCSACSVYRIRCIKGIVMSNYALTQTIVTGSDPRALPEFS
AIREEINKANHPSQPELNWKLVESLALSIFKANGVDLHTATYYTLARTRNQGLAGFCEGAELLAAMIIHE
WDKFWPQSGPARTEMLDWFNTRTGNILRQQVSFSENDLSLLYRTERALQLICDKLQQVELKRQPRVENLL
YFVQNTRKRFEPQPRNRTDTAAQTMVRTLVYAPEGTASATAETMPPLPDLPEMRVGVRGVADNADKAKQG
DTVKGFVAGAACTAVIASALWWWQAYPMQQQLTQVRDTTQGAATVWLASPVLKEYEQYLQQLLNAPPLQP
LETGMQMMRTADTLWPESLQQQEASRMWSNTLRNRAQASPQMKGWQQARQNLRDFADLMMKKETEKQGFT
LSYIKTVTWQAERLLNQETPLEYLLTQYQETRTQKQDTQALEKESNERLDGLLSRWLLLKNTGQDMATDN
RTEPVHPTH
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|218556939|ref|NC_011742.1|:c245424-243925 Escherichia coli S88 chromosome, complete genome
GTGACACCTTTAACGTGCGCTTTAACGTGGACGGCGGCGCAATGGTTTACCAGGTGCATGTGGATACCGA
AGATAACCCGTTCACCGGCGGTCTGTTCAGCCTGTTCCGTTTACCGGATACGTTGTATTAAGGGGATAGT
GATGAGCAATTACGCACTGACACAAACTATCGTTACCGGCAGCGATCCGCGCGCCCTGCCGGAGTTCAGC
GCCATCCGCGAAGAAATTAACAAAGCTAACCACCCGTCACAGCCGGAGCTGAACTGGAAACTGGTGGAAT
CGCTGGCGCTGTCGATTTTTAAGGCCAACGGGGTGGATTTGCATACCGCCACCTACTATACGCTGGCACG
TACACGTAATCAGGGACTGGCAGGGTTCTGTGAAGGCGCGGAACTGCTGGCTGCGATGATCATCCACGAA
TGGGATAAATTCTGGCCGCAGAGTGGTCCGGCGCGGACTGAGATGCTGGACTGGTTCAACACCCGCACCG
GGAATATCCTGCGCCAGCAGGTTTCCTTTTCCGAAAATGATCTTTCGTTGCTCTACCGCACGGAACGGGC
TTTGCAGCTTATCTGCGACAAACTCCAGCAAGTGGAACTGAAGCGCCAGCCGCGCGTGGAAAATCTGCTT
TATTTTGTGCAGAACACACGCAAGCGGTTTGAGCCGCAGCCCAGAAACCGTACTGATACGGCGGCACAGA
CCATGGTCAGAACGCTGGTCTATGCGCCTGAAGGCACGGCTTCCGCCACAGCGGAAACCATGCCCCCCCT
ACCCGACCTGCCGGAAATGCGGGTGGGGGTGCGCGGTGTGGCAGATAACGCCGACAAAGCAAAACAGGGC
GACACGGTAAAAGGTTTTGTTGCCGGTGCCGCCTGTACTGCCGTTATCGCATCTGCACTCTGGTGGTGGC
AGGCGTATCCGATGCAGCAGCAGCTTACACAGGTCAGGGATACCACACAGGGAGCCGCCACCGTCTGGTT
GGCATCCCCGGTACTGAAAGAATATGAACAGTACCTGCAACAGCTTCTGAATGCCCCGCCACTACAGCCG
CTGGAAACCGGAATGCAGATGATGCGCACCGCAGACACCCTCTGGCCGGAAAGCCTGCAACAGCAGGAAG
CCAGCAGGATGTGGAGCAACACGCTGAGAAACCGGGCGCAAGCCAGTCCGCAGATGAAGGGCTGGCAACA
AGCGCGGCAGAATTTGCGGGATTTTGCAGATTTGATGATGAAGAAGGAGACGGAGAAACAGGGTTTCACC
CTATCGTATATCAAAACGGTGACCTGGCAGGCCGAACGGTTACTGAATCAAGAAACACCACTGGAGTACC
TGCTGACGCAGTACCAGGAGACCCGTACACAGAAGCAGGACACACAGGCGTTGGAAAAAGAGAGCAACGA
ACGGCTGGACGGGCTGTTAAGCCGCTGGCTGCTGCTGAAAAATACCGGACAGGATATGGCAACGGATAAC
AGAACCGAACCTGTCCATCCAACTCATTGA