SecReT6
Protein ID: 218557156
SecReT6 ID316
T6SS typei1
Gene symbol-
Locus tagECS88_0235
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]248841..250349 [-]
Producthypothetical protein
NoteTssA
UniProt IDB7MC50
KEGG IDecz:ECS88_0235
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-06, Aligned region: 76..133
ImpA-rel_N [PF06812], Evalue: 1.10E-06, Aligned region: 428..439
Protein Sequence: 502 a.a.     [Download]
>gi|218557156|ref|YP_002390069.1| hypothetical protein ECS88_0235 [Escherichia coli S88]
MTGWHGLLRRYATPATGRENKNMAMDLRNPDVWLAHLLENLPEDKLSAALDDGNADWEFVDSEIVKLGSL
AHSQLDIPELQRRGLMLLASETKDFRLLAHLLRTLQHAGDILLASRMLAQYTEHYWTCAAPQNMAHKKRF
AAQVIKRFESAVQDFAGNAATIQRDALLGELAKLAQCWQAHNASELAKATDDLFSLFQRAFRDVAPEMTS
SARSAAIAPQATTGYVPDMSPHTVAAQPPVAATPIPQVTVENHDDKAWRDTLLKVAAILCERQPESPQGY
RLRRHALWQTITSTPQAESDGRPPLAAFPVDMMDDYLARLNNADMALWQQVEKSLLLAPYWLDGHYLSAQ
TALRLGYKQVADAIRDEVTDFLARLPALINLLFNDRTPFVSEQTKQWLASSGSVNQTVPVVQTDEELQAA
KACFDENGLEAALRYLENLPEGDPRHQFHRQFFGAQLLEEAGMVQLAQQQYRMLFRTGLHMMLSEWEPSL
LKALEQKLTAEQ
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|218556939|ref|NC_011742.1|:c250349-248841 Escherichia coli S88 chromosome, complete genome
TTGACGGGCTGGCACGGGTTATTGCGCCGCTACGCGACGCCTGCCACTGGGCGGGAGAATAAGAATATGG
CAATGGACTTACGTAATCCCGATGTATGGCTTGCACACCTGCTGGAAAACCTGCCAGAAGATAAGCTGTC
CGCCGCGCTTGATGATGGCAATGCAGACTGGGAGTTTGTCGACAGCGAAATCGTCAAGCTCGGTTCACTG
GCGCACAGCCAGCTTGATATCCCGGAACTTCAGCGCCGGGGCCTGATGCTTCTGGCCTCAGAAACCAAAG
ATTTTCGCCTGCTGGCCCACTTGCTGCGTACCCTGCAACATGCCGGTGATATTCTGCTGGCCTCCAGGAT
GCTGGCACAATATACAGAGCACTACTGGACATGCGCCGCACCGCAGAACATGGCCCACAAAAAACGCTTT
GCCGCCCAGGTGATAAAACGCTTTGAGTCTGCCGTTCAGGACTTTGCCGGGAATGCTGCGACAATACAGC
GCGATGCTTTGCTGGGAGAGCTGGCAAAACTGGCACAGTGCTGGCAGGCGCACAACGCGTCTGAGCTGGC
AAAGGCGACAGACGATTTATTTTCCCTGTTTCAGCGCGCGTTTCGTGATGTAGCGCCTGAAATGACATCA
TCTGCACGAAGCGCCGCCATTGCGCCGCAGGCCACGACCGGATATGTACCGGATATGTCACCGCACACGG
TTGCCGCTCAGCCTCCTGTTGCAGCCACTCCAATCCCGCAGGTCACCGTTGAAAACCACGACGATAAAGC
ATGGCGCGACACCCTGCTAAAGGTGGCCGCCATTCTCTGTGAGCGCCAGCCGGAGTCACCGCAGGGTTAC
CGACTGCGCCGCCATGCGCTGTGGCAAACCATCACCAGTACCCCGCAGGCAGAAAGCGATGGCCGGCCCC
CACTGGCAGCCTTCCCTGTCGATATGATGGATGATTACCTGGCGCGGCTGAACAATGCCGACATGGCGCT
GTGGCAGCAGGTGGAAAAAAGCCTGCTGCTGGCCCCGTACTGGCTGGACGGTCATTACCTCTCAGCACAG
ACCGCGCTGCGCCTCGGTTATAAACAGGTGGCGGATGCTATCCGTGATGAAGTTACCGATTTTCTGGCCC
GCCTGCCCGCACTGATCAACCTGTTGTTTAACGACCGCACTCCGTTTGTGTCCGAACAGACGAAACAGTG
GCTGGCATCATCCGGCTCAGTCAACCAGACCGTCCCGGTTGTACAGACCGATGAAGAATTACAGGCGGCC
AAGGCGTGCTTCGATGAAAACGGGCTGGAAGCCGCGCTGCGGTACCTGGAAAACCTGCCCGAAGGTGATC
CCCGCCACCAGTTTCACCGCCAGTTTTTCGGCGCGCAGTTACTGGAAGAGGCCGGTATGGTTCAGCTTGC
ACAACAGCAGTACCGGATGCTCTTCAGAACAGGATTACACATGATGCTATCCGAATGGGAGCCTTCCCTG
CTGAAAGCACTGGAACAAAAACTCACGGCAGAACAGTAA