SecReT6
Protein ID: 218557162
SecReT6 ID316
T6SS typei1
Gene symbol-
Locus tagECS88_0241
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]256436..257878 [-]
Producthypothetical protein
NoteFha
UniProt IDB7MC56
KEGG IDecz:ECS88_0241
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.0012, Aligned region: 94..158
Protein Sequence: 480 a.a.     [Download]
>gi|218557162|ref|YP_002390075.1| hypothetical protein ECS88_0241 [Escherichia coli S88]
MPGIYGCAWRHSRLKGCALAIRPAPASAEPALLVSRKYRPPSQSESGNNSMEPLMAEEKQQSRQASLTLQ
VMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIRHDGAYCLRCLTPGLMINLAP
ASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDSLADTLLTTEGQPAYPGMPFQ
HQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANGINTPFMDLPPGNARHEDGDE
FSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLSLQQQQNSLSDKHLRPLEDNP
LRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVEALRVMLDAFSPGNLMRRFAQ
YRRSHELRQKMDDAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRVLREKQREPEA
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|218556939|ref|NC_011742.1|:c257878-256436 Escherichia coli S88 chromosome, complete genome
TTGCCTGGGATTTACGGCTGTGCCTGGCGCCACAGCAGGCTAAAGGGATGCGCCTTAGCGATCCGGCCAG
CTCCCGCCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGG
GAATAATTCTATGGAACCACTTATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAG
GTGATGAATGGCAACGAACTGGAAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATA
TTGGCCATACGCCGGAATGTCACTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTAC
CGTTATCCGGCACGACGGAGCCTATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCG
GCCTCTTCCGATGCGCTCATCCGCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAG
TGTTTCTGCATGACGGTGCAGCTGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAA
CCGCGACAGTCTGGCGGACACCCTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAG
CATCAGCTTGCCCCCACGGTGGCGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCC
TGATGGTGGCAGATGATCCGATCGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGG
TGCAAACGGGATCAACACGCCGTTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAA
TTTTCTGCCATGGCGCAGTACCACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGC
TGCACAATTCTCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGG
ATTGCTGAGTCTGCAACAACAACAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGACAACCCG
TTGCGCCTTGATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATC
TCGCAGCACCTGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCGGGCGGC
GATTGTGGAAGCGTTGCGTGTCATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAA
TACCGCCGCAGCCATGAACTGCGCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCAACTATT
ACGATGAGCTGGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTA
TGACCGGGTGCTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA