SecReT6
Protein ID: 218557164
SecReT6 ID316
T6SS typei1
Gene symbol-
Locus tagECS88_0243
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]258746..260605 [-]
Producthypothetical protein
NoteTssF
UniProt IDB7MC58
KEGG IDecz:ECS88_0243
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-190, Aligned region: 11..619
Protein Sequence: 619 a.a.     [Download]
>gi|218557164|ref|YP_002390077.1| hypothetical protein ECS88_0243 [Escherichia coli S88]
MCGVISVAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEF
PEFTHGLIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVS
SVACHFTLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYL
WFCECLMDAELIAGEYRLPLPDLWLEAAGFDNRDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAP
LPDDFPINAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAY
DIFQVSTVTSKVKVSGTEISPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLLHHGLEHSIAFVH
ADGSIPGSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTLPLWPVTDGDMHWS
LISAMNLNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTL
WIRPDPFICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQESWEWQEKMGQHALI
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|218556939|ref|NC_011742.1|:c260605-258746 Escherichia coli S88 chromosome, complete genome
TTGTGTGGAGTGATCTCTGTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGC
TAGGCAAACTGCTGGCGCAGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGA
CGTGGAGCGTCTGATGGAAGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTC
CCCGAGTTCACCCATGGGCTGATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGG
TTATTGCCTATGAACCCAAAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAG
AAGCCGCTCAGAAAAGTCCTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCT
TCCGTAGCCTGCCATTTCACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCA
ACGCCAGCAGCCTGAAAGAAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCAT
GCTTGACCTGAACAAAATCACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTG
TGGTTTTGCGAATGCCTGATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGT
GGCTGGAGGCGGCGGGTTTTGACAACCGGGATGCTCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTA
CCGCGTGCTTCAGGAGTATTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCG
CTACCAGACGATTTCCCGATCAATGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACA
TCAAGCTGCGCCAGGATTCGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGA
ACCCGTCAGGCCGGATGGGCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTAT
GACATTTTTCAGGTCAGCACAGTCACCAGTAAAGTCAAAGTTTCAGGTACTGAAATCAGCCCAGGTAGCC
AGGCGCGTGTCTGGCCCGAATTTGAAAGCTTCCAGCACCAGATGGAGTACAGCCGCCAGCGAGAAGTCGT
CTACTGGCATCACCGGACTAAAACGTCCCTGCTTCACCACGGGCTTGAACACTCTATCGCCTTTGTCCAT
GCAGACGGTAGCATTCCGGGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCA
ACCGTATGATCCCTGCCCGGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGC
CTCATTTCGTAATGTCACGCGCCCGACACTGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCG
CTGATTTCCGCGATGAACCTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGA
CCTTCGACCTGCCAGGTGCTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGA
AAAACTCGAAACCAAACCTGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTG
TGGATACGTCCCGATCCGTTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCT
TTGCCCTCTACGCCAGCATCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGTCCTG
GGAATGGCAGGAGAAAATGGGCCAGCACGCCCTGATATAG