SecReT6
Protein ID: 218557165
SecReT6 ID316
T6SS typei1
Gene symbol-
Locus tagECS88_0244
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]260593..261018 [-]
Producthypothetical protein
NoteTssE
UniProt IDB7MC59
KEGG IDecz:ECS88_0244
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-20, Aligned region: 30..123
Protein Sequence: 141 a.a.     [Download]
>gi|218557165|ref|YP_002390078.1| hypothetical protein ECS88_0244 [Escherichia coli S88]
MLRRDSGPTGSLFERIREAANPPSYQNPKEALIRSIRRNLRQVLNTRSGSCYGSPELGITDLNDESLASS
DFRREIRKSISQCILHYEPRITDVVVTAAAPDEYAPVELCFHIVATVDVSETRGVFEFDIFLDNHQRYCV
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|218556939|ref|NC_011742.1|:c261018-260593 Escherichia coli S88 chromosome, complete genome
ATGCTAAGACGGGATTCAGGACCAACCGGCAGTCTTTTTGAACGTATCCGTGAGGCGGCAAATCCGCCTT
CATATCAGAATCCAAAAGAAGCACTGATACGTTCCATCAGACGTAACCTGCGACAGGTCCTGAATACCCG
CTCCGGCAGTTGTTATGGTTCACCGGAGCTGGGGATTACTGATTTAAATGATGAATCGCTGGCCTCCAGC
GATTTCAGACGAGAAATCCGTAAGTCCATTAGCCAGTGCATTTTACATTACGAACCTCGTATTACCGATG
TTGTTGTTACGGCTGCTGCACCGGATGAATACGCCCCTGTGGAACTGTGTTTTCATATTGTGGCTACGGT
CGATGTCAGCGAAACCAGGGGAGTGTTTGAATTTGACATTTTTCTGGACAACCATCAACGCTATTGTGTG
GAGTGA