SecReT6
Protein ID: 218557166
SecReT6 ID316
T6SS typei1
Gene symbol-
Locus tagECS88_0245
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]261023..262507 [-]
Producthypothetical protein
NoteTssC
UniProt IDB7MC60
KEGG IDecz:ECS88_0245
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-183, Aligned region: 67..491
Protein Sequence: 494 a.a.     [Download]
>gi|218557166|ref|YP_002390079.1| hypothetical protein ECS88_0245 [Escherichia coli S88]
MSVKEEIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYGQFGGEPVAAVIGNFAFKNTTPDMKLLKYISQVSAMAHSPFLSSVSSEFFGLDSWTELPG
IKEPGAIFEGPAYSRWRALRESEDSRYLGLTAPRFLLRHPYSPDENPVKTFRYHEDVSQSHESYLWGNTS
FLLAANLAESFAKYRWCPNIIGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLT
MRKGSDNACFFSANSVQKPKTFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSD
LERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMGASFDLSLVGR
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|218556939|ref|NC_011742.1|:c262507-261023 Escherichia coli S88 chromosome, complete genome
ATGTCAGTAAAGGAAGAAATTGCTCCCGTCAGCGCGTCTCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAAGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCG
TATTACAAGCATGTATATTCAAGCGGTTACGGACAATTTGGCGGTGAGCCAGTGGCGGCGGTAATCGGCA
ACTTTGCCTTTAAGAACACCACGCCGGATATGAAGCTGCTGAAATATATCAGCCAGGTCAGCGCGATGGC
GCACAGCCCGTTCCTGTCGTCAGTATCATCCGAATTTTTCGGTCTGGATTCATGGACAGAGTTACCGGGG
ATCAAAGAACCGGGTGCCATCTTTGAAGGCCCGGCCTACTCCCGCTGGCGCGCCCTGCGTGAATCGGAAG
ATTCCCGTTACCTGGGCCTGACCGCCCCCCGGTTCCTGCTGCGCCACCCTTACTCACCGGATGAAAACCC
TGTCAAAACCTTCCGTTACCATGAAGATGTCAGCCAGAGTCATGAGTCTTATCTGTGGGGGAATACCTCG
TTTTTACTGGCCGCCAACCTGGCGGAAAGTTTTGCTAAGTATCGCTGGTGCCCAAATATTATTGGCCCTT
CCAGCGGCGGCGCAGTCAAAGACCTCCCGGTGCATCTGTATGAATCCATGGGGCAAATGCAGGCAAAAAT
TCCGACTGAAGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGGAAGAGGGCTTTATCACACTGACC
ATGCGTAAAGGGTCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGTGCAGAAACCCAAAACATTCCCCA
AAACCCCCGAAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACCCAGCTGCCATACTTGTTTGTTAT
CAGCAGGTTAGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTGGCTCATGGAAAGAACGTAGTGAC
CTGGAGCGTGAGCTGAACACCTGGATTCGCCAGTATGTTGCTGACCAGGAAAATCCGCCTGCCGAAGTCC
GCAGCCACCGGCCTTTGCGTCAGGCTAAGATCGAGGTACTGGATGTGGATGGTGAGCCGGGCTGGTACCA
GGTCGCGATTTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTTTCGACCTGAGCCTGGTCGGACGA
CTGGATAAGGAATAA