SecReT6
Protein ID: 218557167
SecReT6 ID316
T6SS typei1
Gene symbol-
Locus tagECS88_0246
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]262530..263084 [-]
Producthypothetical protein
NoteTssB
UniProt IDB7MC61
KEGG IDecz:ECS88_0246
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.30E-48, Aligned region: 27..179
Protein Sequence: 184 a.a.     [Download]
>gi|218557167|ref|YP_002390080.1| hypothetical protein ECS88_0246 [Escherichia coli S88]
MYAVRKCCAHGLNGNIFMSKMNNNGGSVAPKERISVRYTPKVDGVAADIELPLNLLITGNLKGKPDNTPL
DERTAIAINRYNLNAVISEADIEREFVVPAELSDAPNEQMYVNLKVKSMDDLSPDHIASQVPEIKRLLEL
REALVALKSPLGNIPAFRAQLQALLENEDTREQLIQELGIAVQK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|218556939|ref|NC_011742.1|:c263084-262530 Escherichia coli S88 chromosome, complete genome
TTGTATGCAGTACGAAAATGCTGTGCTCATGGCCTGAACGGGAACATTTTTATGAGCAAAATGAACAACA
ATGGCGGCAGTGTCGCGCCGAAAGAAAGAATCAGCGTTCGGTATACACCAAAAGTTGATGGGGTGGCTGC
TGATATCGAATTGCCGCTGAATTTATTGATCACCGGCAATCTGAAAGGGAAACCAGATAACACGCCGTTG
GATGAGCGAACTGCCATTGCTATCAACCGCTATAACCTCAACGCAGTCATTTCAGAAGCTGACATTGAAC
GGGAGTTTGTTGTTCCGGCTGAACTCAGTGACGCTCCCAATGAGCAAATGTACGTCAACCTGAAAGTCAA
ATCTATGGATGACCTTTCTCCTGACCATATTGCCAGCCAGGTACCAGAAATAAAACGTCTGCTCGAATTG
CGTGAAGCCCTAGTCGCACTTAAGTCTCCACTAGGCAATATTCCAGCCTTCCGCGCACAACTTCAGGCGC
TACTGGAAAACGAAGACACCCGCGAGCAGCTGATCCAGGAACTGGGTATCGCCGTTCAGAAATAA