SecReT6
Protein ID: 218559802
SecReT6 ID317
T6SS typei2
Gene symbol-
Locus tagECS88_3083
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]3034518..3035039 [+]
Producthypothetical protein
NoteTssB
UniProt IDB7MLD5
KEGG IDecz:ECS88_3083
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.00E-52, Aligned region: 13..165
Protein Sequence: 173 a.a.     [Download]
>gi|218559802|ref|YP_002392715.1| hypothetical protein ECS88_3083 [Escherichia coli S88]
MDDEEKDMADSFQNEVPTARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINKNNF
NSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDN
ATFRRELENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 522 bp     [Download]
>gi|218556939|ref|NC_011742.1|:3034518-3035039 Escherichia coli S88 chromosome, complete genome
GTGGATGATGAGGAAAAGGATATGGCTGACAGTTTCCAGAATGAAGTTCCCACCGCTCGTGTAAATATCA
AGCTTGATCTGCATACAGGCAATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCCGTAGGCGA
TTACAGTAACGGAAAAGAGCAACGTCCGCTGTCCGAACGGGACAAGGTTGATATCAATAAAAACAACTTC
AACAGCGTCATGGCTGAGTTTTCGCCTGCGGTTAATTTAACAGTAGAAGATACGCTAAACGGAAACGGTA
ATGAACAAAATATCGCGCTTGAATTTAAAAGCCTGAAGGATTTTGAACCCGAACAGGTAGCAAAAAATAT
TCCGCAACTTCGTGTATTACTCGCTATGCGCAATTTACTACGTGACCTGAAATCCAATCTGCTGGATAAC
GCAACGTTTCGCCGTGAACTGGAAAATATTCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAAC
TGGCGAAAATTGCGCCGCAGGAGAACGTTTAA