SecReT6
Protein ID: 218559803
SecReT6 ID317
T6SS typei2
Gene symbol-
Locus tagECS88_3084
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]3035092..3036636 [+]
Producthypothetical protein
NoteTssC
UniProt IDB7MLD6
KEGG IDecz:ECS88_3084
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-173, Aligned region: 90..510
Protein Sequence: 514 a.a.     [Download]
>gi|218559803|ref|YP_002392716.1| hypothetical protein ECS88_3084 [Escherichia coli S88]
MLMSVQQEHSTSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLL
SCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELL
DISKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHM
PFIGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVR
SFNYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIP
SEVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAH
YLKIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFA
VPHFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|218556939|ref|NC_011742.1|:3035092-3036636 Escherichia coli S88 chromosome, complete genome
ATGCTGATGTCTGTACAACAAGAACATTCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCG
GCGTTTATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTCTCTTCCATTCAGGAAATAGATTTATG
GCAAAACAGCGAAACGCTGGCTGATGCCTCACCCGATGAGCGCGTGACAGCAGCGATTCACGTTCTGCTT
TCCTGTCTGGCGAAATCAGGCGAGGACGTGGTTAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACG
ATCTGGATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTC
GCTGTGGCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTG
GATATCAGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATC
GTCATACATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGA
ATTTGATAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATG
CCTTTTATCGGTTCCGTCGGACCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAG
ATATCGGCAACTACTTTGACCGCGCAGAATATATTAAATGGAAGTCGTTCCGCGATACGGATGACAGCCG
CTATGTGGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGC
AGCTTTAACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTACCTGTGGACAAACGCCTCGTTCG
CCTTTGCCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGTGTGCAGATCCGTGGTCCACAGGC
AGGTGGCGCAGTAGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCG
TCCGAAGTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTTGGCTTTATTCCGCTCTCTTATT
ATAAGAATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCCGCCCAGAAACCGGCGTTGTATGATACCGC
TGACGCCACCGCCAACAGCCGTATTAACGCCCGTCTGCCTTACATCTTCCTGCTGTCCCGCATTGCGCAT
TACCTGAAAATCATTCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGA
ACACCTGGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCT
GCGCGACGGCAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCC
GTGCCGCATTTCCAGATTGAAGGGATGGATATCAACCTTTCTCTGGTTTCCCAGATGCCGAAAGCGAAAG
CCTGA