SecReT6
Protein ID: 218559804
SecReT6 ID317
T6SS typei2
Gene symbol-
Locus tagECS88_3085
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]3036654..3037991 [+]
Producthypothetical protein
NoteTssK
UniProt IDB7MLD7
KEGG IDecz:ECS88_3085
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|218559804|ref|YP_002392717.1| hypothetical protein ECS88_3085 [Escherichia coli S88]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDCIAQLCIRHPWGIANVLFDRDALTPGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLRALKNDSAIVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVQLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGSCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|218556939|ref|NC_011742.1|:3036654-3037991 Escherichia coli S88 chromosome, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACTGTATTGCGCAGCTTTGTATTCGCCATCCGTGGGGGATCGCAAACGT
GCTCTTTGACCGGGATGCCCTGACGCCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCAGACGTGAGTGACGTTCTGCCGCTCGCCTGCGATCTGCGCGCGCTGAAGAACG
ACAGCGCGATTGTTTTGCTGGCGCTGCCGCTTGCACATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTGCGCTATCGTCAGGAATGGCAAAAGGTGCAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGCTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGGCTGGTACAGCGTCTGGACACATTGCTGTTGCAGCTACGGGCGAAG
TGCCAGCGTCTGATGGCGATGCGCCGGGAAAGCAACCAGCGTATGGCGGACTTTGCCGTCGCCGATGTCT
CCCTGTTCTGGCTGCTTAACGCGCTGAATTCCGCCGAGCCGGTGCTGAGCGATTTCCTGCGCTACCCGGC
TGTCCACCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGTGCGCTGCTGACGTTTTCCCTTGAG
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCACCGTCTTTCCGCCCCTGTTCTCCC
TGCTCAGCGAGCTGCTGGAAGCCAGCCTGCCGTCGCGGGTGATCGCGCTGGATCTGGCGTCCCTGCCGGG
CAACCGCTGGAAAGCCGACCTGCACGATCCGCGACTGCGGGAAGAGGCCGATTTTTATCTGTCCGTTCGT
TCCTCACTGCCTGCGCATCAGGTACTGCATCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCCGATGATG
TCACGCTGCTTATCAACGTGGCGCTGAACGGTGTTCAACTGGTGCCGCTTACCTCGGTTCCGGCGGCGCT
GCCGCTGCGGCTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGAGCTGCATGATTTATGCGCCGGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA