SecReT6
Protein ID: 218559810
SecReT6 ID317
T6SS typei2
Gene symbol-
Locus tagECS88_3091
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]3046168..3047382 [+]
Producthypothetical protein
NoteTle4 (e)
UniProt IDB7MLE3
KEGG IDecz:ECS88_3091
PDB IDNA
Domain hit(s) vs Pfam PGAP1 [PF07819], Evalue: 1.10E-07, Aligned region: 41..53
PGAP1 [PF07819], Evalue: 1.10E-07, Aligned region: 243..279
LCAT [PF02450], Evalue: 0.0011, Aligned region: 260..312
Abhydrolase_6 [PF12697], Evalue: 0.0014, Aligned region: 256..285
Abhydrolase_5 [PF12695], Evalue: 0.0059, Aligned region: 225..281
Protein Sequence: 404 a.a.     [Download]
>gi|218559810|ref|YP_002392723.1| hypothetical protein ECS88_3091 [Escherichia coli S88]
MICRIVRKTECIQGEIMTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSM
SLMGWSLPTSGPKERKRLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDIL
DNIEPEAKLFGSRKDRGWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSL
DEEYLEVIRLYQFPVHVVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFS
ECLSGNTDVYGIVHGVLPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELL
PMNDYGEEWLNIVDRDGSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWMRIY
 
Nucleotide Sequence: 1215 bp     [Download]
>gi|218556939|ref|NC_011742.1|:3046168-3047382 Escherichia coli S88 chromosome, complete genome
TTGATCTGCCGGATAGTCAGGAAAACTGAGTGCATACAGGGGGAAATTATGACATCGACGATGCATATGG
ACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTACGGGTTATTCCGGTTATTTTTCT
GCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCATCTGGCGATATGATGACTCTATG
AGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAAAGATTATTGCATCCTGACAGGG
TGGAGGTCGATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAGAAAAACTTATTCAGTTAGGTCA
ACAATATCCGGAGGACCCATCCGATAAAGAAGCAATGGATAATTACACTCAGGCAGTACGTGACATTTTG
GATAATATAGAGCCAGAAGCGAAATTATTTGGTTCAAGAAAAGATCGCGGCTGGGGAGAGGTTGCAAATG
CTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCATTGTACCGGGACAAACCTACAAAGAAAGGTGA
GACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTTGGAGTATGGTCCTGACTCACTT
GATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCATGTCGTTGGCTATAACTGGCTTG
GTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAATTGTTGGAGGCTATCAAAAACG
AGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGGACTAGTGGCAAGGTACTTTTCA
GAGTGTCTTTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTATTACCATCAATTGGTGCTGCGG
CGACATATACCCGAATGAAACGTGGAACTGAAAACCCAGAGTCAAATCCGGAAGGGTATGTTATCAGTCA
TATCTTAGGTCGTAATGCAGCTGAAATGGTAGCTGTTTTTTCCCAGTCGCCAGGACCAATGGAATTACTA
CCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGTCGATCGTGATGGTAGTACATTAACGCTCCCTA
AAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACGCTGAACTTTATCTAAATAGAGA
AAATTGGTGGATGAGAATCTATTGA