SecReT6
Protein ID: 218559812
SecReT6 ID317
T6SS typei2
Gene symbol-
Locus tagECS88_3093
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]3047950..3048783 [+]
Producthypothetical protein
NoteTli4 (i)
UniProt IDB7MLE5
KEGG IDecz:ECS88_3093
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 277 a.a.     [Download]
>gi|218559812|ref|YP_002392725.1| hypothetical protein ECS88_3093 [Escherichia coli S88]
MVKCHTLINRRNKCLLIVFIVLIGWIIFRPKAYTYSLNDKEKEMLIMLSQHPETRYFGFYSIELPADYKP
TGMVMFIQGSAMIPVETKLQYYPPFLQYMTRYEAELKNTSALDPLDTPYLKQVHPLSPPMNGVIFERMKA
KYTPDFARVLDAWKWENGVTFSVKIEAKDGRATRYDGISKIAEYSYGYNIPEKKVQLLTILSGLQPRADN
QPPSENKLAIQYAQVDASLLGEYELSVDYKNSNNIKISLQTDNNSYIDSLLDIRYPSNGNRAWYNSI
 
Nucleotide Sequence: 834 bp     [Download]
>gi|218556939|ref|NC_011742.1|:3047950-3048783 Escherichia coli S88 chromosome, complete genome
ATGGTAAAATGTCATACTCTGATTAACCGTAGAAATAAATGTCTGCTGATTGTTTTTATAGTCCTTATTG
GATGGATTATATTCAGACCTAAAGCATATACTTATTCACTAAATGATAAAGAAAAAGAGATGCTCATAAT
GTTATCACAACATCCTGAAACTCGGTACTTTGGATTTTATTCCATAGAACTTCCGGCTGATTACAAACCA
ACAGGAATGGTTATGTTCATACAAGGATCGGCGATGATCCCTGTAGAAACAAAGCTACAATATTATCCTC
CTTTTCTGCAATATATGACACGATATGAGGCAGAACTAAAAAACACCTCAGCATTAGATCCACTGGATAC
GCCTTATTTGAAGCAAGTTCACCCACTAAGTCCACCTATGAATGGAGTCATTTTTGAACGAATGAAAGCG
AAATACACCCCAGATTTTGCACGAGTATTGGATGCATGGAAATGGGAAAATGGCGTTACGTTTTCAGTAA
AAATAGAAGCTAAAGATGGTAGAGCAACCCGCTATGATGGAATTAGTAAGATTGCCGAATACAGTTATGG
ATATAATATTCCAGAAAAAAAAGTACAGTTACTTACTATTCTTTCAGGACTACAACCTCGTGCAGATAAC
CAACCCCCATCAGAAAATAAATTGGCGATACAATATGCACAGGTTGACGCTTCACTACTTGGAGAGTATG
AATTATCTGTAGATTATAAAAATAGCAATAATATTAAAATAAGTTTGCAGACGGATAATAATAGTTATAT
TGACTCATTATTAGATATAAGATATCCGAGTAATGGAAACAGAGCATGGTATAACTCTATATAA