SecReT6
Protein ID: 218559823
SecReT6 ID317
T6SS typei2
Gene symbol-
Locus tagECS88_3106
StrainEscherichia coli S88
Repliconchromosome [GenBank: NC_011742] [Browse all T6SS(s) in this replicon]
Location [Strand]3062907..3064283 [+]
Producthypothetical protein
NoteTssA
UniProt IDB7MLF7
KEGG IDecz:ECS88_3106
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 2.40E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 5.80E-17, Aligned region: 42..100
Protein Sequence: 458 a.a.     [Download]
>gi|218559823|ref|YP_002392736.1| hypothetical protein ECS88_3106 [Escherichia coli S88]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRQVEKLSLALFRQNGVELQTLVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
STIETTLQQCELWHMTKLDVLSGQFRNTALRLERLAPQGAETTITPPELPRREMNQPKKSEESPQPVFAT
RSVQQNDKDASPPVPSPEISRQRTWPIFMAGMVVMAGLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSAEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|218556939|ref|NC_011742.1|:3062907-3064283 Escherichia coli S88 chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACGTATAAGGAATCCG
GTGAACTGCAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGGCCAGACGTGGACTGGCGCCAAGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAACTACAGACGCTGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGATATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGCTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATCTACCGTTGTGTACAGCATCTT
TCTACCATAGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAGCTGGACGTATTGTCCGGGC
AGTTTCGCAATACCGCATTGCGTCTGGAACGGCTGGCGCCTCAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAATCAACCGAAAAAGTCAGAGGAAAGTCCACAGCCGGTTTTTGCAACC
AGATCCGTTCAGCAAAACGATAAGGATGCCAGTCCACCCGTTCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCGGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCGCTAATCCAGCGAATACAACTGTCTGTCATGCCGTTGCCGCAGTCGCTG
GAGAGCGGCGAACTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAAGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGGGCGCTGAACGCGCAGTGGCGCAAA
CAGCGGGAGCTGAGCGCCCTGTCTGCTGAGGCACTGAATGGCTATGCTCAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAACGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCAACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGTTGA
ATCGCTATGTCATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA