SecReT6
Protein ID: 218676746
SecReT6 ID318
T6SS typei1
Gene symbolvasF
Locus tagVS_II0985
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1088148..1088954 [-]
ProductType VI Secretion System, VasF
NoteTssL
UniProt IDB7VTS2
KEGG IDvsp:VS_II0985
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.20E-54, Aligned region: 51..253
Protein Sequence: 268 a.a.     [Download]
>gi|218676746|ref|YP_002395565.1| Type VI Secretion System, VasF [Vibrio splendidus LGP32]
MGCTFMSYVENDITVVLFQPEPGKPMEVMPAPDLSRNIAVRDLNVESMGVNPLVDQFTWLIASLSCMSSI
PWLDDPGPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVCRQEWGANSHWSTNSLLSEFH
NETSGGDKFFTILERLKADPRKYRHVIEFLYLLLQLGFKGKYGREDRGNEKLSEIGNTIYRLVRDERLAE
QEKVTLVNLKAKYLKKPLKRVVSPKLILGVSAAIFGVMYVATYLVIDLKFQQLLDVYQ
 
Nucleotide Sequence: 807 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1088954-1088148 Vibrio splendidus LGP32 chromosome 2, complete sequence
TTGGGCTGTACGTTTATGAGTTACGTCGAAAACGATATCACCGTAGTACTATTCCAACCAGAACCAGGCA
AACCAATGGAGGTGATGCCTGCACCTGATTTATCTAGGAATATTGCGGTAAGAGACCTAAATGTAGAAAG
CATGGGGGTTAACCCATTGGTTGATCAGTTTACCTGGTTGATCGCCAGTCTTTCATGTATGTCTTCAATT
CCTTGGCTGGACGACCCTGGCCCTTTCAGAGAACAAGTTGCTCGAGAGATTCGCAAAGGTGAGCGAAAGC
TTAACGAAATGGAATTGGATAGGGCATCTATTCTGGTTATACGCTATTGCTTATGTGCTGCAATCGATGA
ATCTGTATGTCGCCAAGAGTGGGGGGCGAACAGCCATTGGAGTACCAATAGCTTATTGTCAGAGTTCCAT
AACGAAACATCTGGTGGCGACAAATTCTTCACTATTTTAGAGCGTTTGAAAGCTGACCCACGAAAATATA
GACACGTCATCGAATTCCTTTATCTATTACTTCAACTTGGGTTCAAAGGAAAATATGGTCGAGAAGACCG
TGGTAACGAAAAGCTTTCAGAGATAGGAAATACGATTTATCGTTTAGTTAGAGACGAGCGTTTAGCTGAA
CAAGAAAAAGTAACGTTAGTTAATTTAAAGGCGAAGTACTTAAAAAAGCCGCTAAAACGTGTTGTTTCAC
CGAAGTTAATTCTTGGGGTTAGTGCTGCCATTTTTGGCGTTATGTATGTCGCGACCTACTTGGTTATTGA
CCTGAAATTTCAGCAACTTCTAGATGTATATCAGTAG