SecReT6
Protein ID: 218676747
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0986
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1088936..1090261 [-]
Producthypothetical protein
NoteTssK
UniProt IDB7VTS3
KEGG IDvsp:VS_II0986
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-141, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|218676747|ref|YP_002395566.1| hypothetical protein VS_II0986 [Vibrio splendidus LGP32]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSNMLSSNSSPLHWGVKKIEINTELLALGKIGITRAEGILQ
DRTPFDLPLLAELPEVRDVDPSIADKVVYLCCPLPSERSELFGESSDGARYKMESQEAVDACYESEDMAS
IVVGKLNFFLMYDHEDKSAYTSIPILKISEVKPDGSIILDENYIPTCIDIHASTVLSKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVADFMLLQALNRYEPLFWHFASVEGVHPESFYRTLLQAEGELSTLCSASRRP
QEFTKYNHRQLTDCLSRTLDSAKMTLSVMSEQRAIPLTLREQSYGIRTAAIPDSKIVESTTFILAVKADV
PLDILHTQFVSQTKIGSIDNIRDLINLQLPGIEMKPMPVVPRALPYHAGYTYFELDKTSDEWSTLNNAAA
IAVHIAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1090261-1088936 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGTCTTTATATAACCCAGTGGTTTGGCAAGATGGTATGTTCATGAAGCCTCAGCACTTCCAACAGCTAG
ATAGGTCTCAAAGCAAATTATCTAACATGCTTAGCTCTAACAGCTCTCCTTTACATTGGGGAGTGAAAAA
AATCGAGATAAACACCGAACTATTGGCGTTAGGCAAAATCGGGATCACGCGAGCAGAAGGCATATTACAA
GATCGCACACCATTTGATTTGCCGCTTCTTGCCGAACTTCCCGAAGTAAGAGATGTTGACCCATCTATAG
CTGATAAAGTGGTGTACCTGTGCTGCCCATTGCCATCCGAGCGCTCTGAACTTTTTGGTGAAAGTAGTGA
TGGTGCCCGCTATAAAATGGAAAGCCAAGAGGCCGTGGATGCCTGTTATGAATCAGAAGACATGGCAAGT
ATTGTCGTGGGTAAGCTTAACTTCTTCTTGATGTACGATCACGAGGATAAGAGTGCATATACATCCATTC
CTATTTTAAAAATTTCGGAAGTCAAGCCAGATGGAAGCATTATTCTGGATGAGAACTATATCCCGACATG
CATCGATATACACGCTTCTACAGTTTTGAGTAAGTTCGCGACAGAATTCGCTTCAATGCTAAAACACAGA
GCAGAATCGATTGTTCAGCGTTTAGGTGTGGTTGACCAACAGGGGGTATCATCTGTTGCTGATTTTATGT
TGTTACAAGCCTTAAATCGTTATGAGCCGTTATTCTGGCATTTTGCTAGTGTAGAGGGTGTTCATCCAGA
GTCGTTTTATCGAACCCTGTTACAAGCTGAAGGTGAACTCTCTACGTTGTGCTCAGCCTCTCGTAGACCG
CAAGAGTTTACAAAATACAACCACCGCCAATTGACTGATTGTTTATCTCGCACGCTTGATAGCGCAAAAA
TGACGCTAAGCGTGATGTCAGAGCAACGGGCAATACCTTTAACACTAAGAGAGCAAAGCTACGGAATTCG
AACGGCAGCAATCCCAGACAGTAAGATTGTCGAATCTACAACGTTTATTCTTGCGGTTAAAGCAGACGTA
CCACTCGATATTTTACATACACAGTTTGTAAGTCAAACTAAGATTGGTTCGATTGACAACATTCGTGATT
TGATCAACTTACAACTACCTGGCATAGAAATGAAACCAATGCCAGTTGTGCCTCGAGCGTTACCTTACCA
TGCAGGTTATACCTATTTTGAATTGGATAAAACGAGCGATGAATGGAGTACCTTGAATAACGCAGCGGCC
ATCGCTGTCCATATTGCTGGTGACTTCGCGAACTTATCACTACAACTTTGGGCTGTACGTTTATGA