SecReT6
Protein ID: 218676748
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0987
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1090273..1090788 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB7VTS4
KEGG IDvsp:VS_II0987
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.10E-34, Aligned region: 16..157
Protein Sequence: 171 a.a.     [Download]
>gi|218676748|ref|YP_002395567.1| hypothetical protein VS_II0987 [Vibrio splendidus LGP32]
MPKRIMHKLIAPIILFLLSGCSMWEQFKESSGITPETSSIELVIEASEHLNIREQGQSSPVILRVHELTS
PVMFRSLDFFALFENDKASLGDEYIKRYEYQLQPGDKLHELLELDPKTRALGFSVAFRNINGSSWRKVEV
IEEKSEYFLRLKVEGSELSSNNTRGIEQTYF
 
Nucleotide Sequence: 516 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1090788-1090273 Vibrio splendidus LGP32 chromosome 2, complete sequence
TTGCCAAAACGAATCATGCATAAACTAATAGCTCCTATTATCTTGTTCCTTTTATCAGGTTGTTCAATGT
GGGAACAGTTCAAAGAATCTTCTGGAATAACGCCGGAAACCTCTTCGATTGAACTAGTTATTGAAGCGTC
AGAACACCTCAATATACGCGAACAAGGACAATCATCGCCAGTCATCTTGAGAGTTCACGAATTAACGTCT
CCCGTTATGTTCCGTAGTTTGGACTTCTTTGCTCTATTTGAAAATGATAAGGCCTCCTTGGGGGACGAGT
ACATCAAACGGTACGAATATCAGCTTCAGCCCGGTGATAAGCTGCATGAGCTGTTGGAGCTAGACCCAAA
AACTAGAGCACTAGGTTTTTCTGTCGCATTTAGAAATATTAATGGTTCATCTTGGCGTAAGGTCGAAGTG
ATCGAAGAGAAAAGTGAGTACTTCTTAAGGTTAAAAGTAGAGGGTAGCGAATTATCTTCGAACAATACCC
GCGGTATTGAACAGACGTATTTTTAA