SecReT6
Protein ID: 218676749
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0988
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1090766..1092253 [-]
Producthypothetical protein
NoteFha
UniProt IDB7VTS5
KEGG IDvsp:VS_II0988
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.10E-15, Aligned region: 31..97
FHA [PF00498], Evalue: 1.10E-15, Aligned region: 165..182
Protein Sequence: 495 a.a.     [Download]
>gi|218676749|ref|YP_002395568.1| hypothetical protein VS_II0988 [Vibrio splendidus LGP32]
MRINQLILVISKCPEEYVGAKNIEVPEEGGSLGREAGCTVTLTDHNRFISGTHCLLSIYGDTYYISDVST
NGTLVNGNKILKNQPVSLCDGDKISLGQYEVSISLELVTTSYDIASEIAPERDSTDPLMNLEKSVVEEDV
EPGALEDLFMETKPDDVDSHDPVEHLKFSMQRDDDYLVRDESNDKNLASTSIEPQRQVVDDSLSIHSEFD
LPNLIPEDWMGLEEEAPTTLHAHNLDNEEEIPGYVQPIHDKDLNGKPEDVIERSSVSKHTSIPVQSVVSA
RSSANIQSHKWEEVTQEFVPHVETQELCAESESRSQNNVALSESSSENVTHAFFEGLGADIETDSNHDAL
FFKQMGACLRLCIDNLYKNLQGVEELTDENSFTKNELSLTTLMLTLNNQNLLAPNELIEQILDELDEHDA
LYLKTLNDLVFDQLKANDPKKFEDVLSQETRFLSKSKLWQKYGEHYDQNTRQLHESTFKALIKERYNKVA
KTNHA
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|294510242|ref|NC_011744.2|:c1092253-1090766 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGAGAATAAATCAACTGATTTTGGTGATCTCGAAGTGCCCAGAAGAGTACGTTGGTGCTAAGAATATAG
AGGTGCCTGAAGAAGGAGGCTCTTTAGGACGAGAAGCAGGCTGTACCGTAACATTAACGGATCACAACCG
ATTTATATCTGGTACGCATTGTTTATTGAGTATATATGGAGATACCTATTACATTAGTGATGTCAGTACA
AATGGCACGTTGGTGAATGGTAATAAGATCCTAAAGAATCAACCAGTCTCATTGTGTGATGGTGATAAGA
TATCCCTTGGCCAGTATGAAGTTAGTATATCGTTAGAATTGGTCACAACATCATACGATATTGCCTCTGA
AATCGCCCCAGAAAGAGATTCAACCGATCCACTAATGAATTTGGAAAAGTCAGTTGTTGAAGAGGACGTT
GAACCTGGCGCACTTGAAGACCTTTTTATGGAAACAAAACCTGACGACGTAGACAGTCATGACCCCGTTG
AGCACTTAAAGTTTTCGATGCAAAGAGACGACGATTATCTTGTTAGGGATGAAAGTAATGATAAAAACCT
TGCGAGCACGTCGATCGAACCTCAAAGGCAAGTTGTTGATGACAGTTTGAGTATTCACTCGGAGTTTGAC
CTACCTAATTTGATTCCTGAAGATTGGATGGGATTAGAAGAAGAGGCCCCGACGACTCTTCATGCACATA
ATCTTGATAACGAGGAAGAAATACCGGGTTACGTACAACCTATTCATGATAAAGATTTAAACGGCAAACC
TGAAGACGTTATTGAACGTTCTTCTGTTTCTAAGCATACGTCAATTCCGGTGCAATCTGTTGTTAGTGCC
CGAAGTTCTGCGAATATACAAAGCCACAAATGGGAAGAGGTGACACAAGAGTTTGTCCCACATGTTGAGA
CTCAAGAACTGTGTGCGGAAAGCGAAAGTAGATCTCAGAATAATGTCGCCCTGAGTGAATCATCATCTGA
GAACGTAACACATGCATTCTTCGAAGGCCTCGGTGCAGATATAGAAACTGATTCAAATCATGACGCTCTA
TTTTTTAAGCAAATGGGCGCGTGTTTACGATTGTGTATCGATAATCTGTACAAAAACTTACAGGGTGTTG
AAGAACTTACAGACGAAAACTCGTTTACTAAGAATGAGCTTAGCCTAACCACGTTAATGTTAACGCTAAA
CAATCAAAATCTGTTAGCTCCAAATGAGCTCATTGAACAGATTTTGGATGAGCTTGATGAACATGACGCT
TTGTATTTAAAAACACTCAACGACCTTGTGTTCGATCAGTTAAAAGCGAACGACCCCAAAAAATTCGAAG
ATGTATTAAGCCAAGAAACCCGTTTTCTAAGTAAATCGAAGTTATGGCAAAAGTACGGGGAACATTATGA
CCAGAATACTCGTCAACTCCATGAATCGACATTCAAAGCGTTGATTAAAGAACGATACAATAAGGTTGCC
AAAACGAATCATGCATAA