SecReT6
Protein ID: 218676751
SecReT6 ID318
T6SS typei1
Gene symbol-
Locus tagVS_II0990
StrainVibrio splendidus LGP32
Repliconchromosome II [GenBank: NC_011744] [Browse all T6SS(s) in this replicon]
Location [Strand]1093545..1094858 [+]
Producthypothetical protein
NoteTssA
UniProt IDB7VTS7
KEGG IDvsp:VS_II0990
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-17, Aligned region: 46..104
Protein Sequence: 437 a.a.     [Download]
>gi|218676751|ref|YP_002395570.1| hypothetical protein VS_II0990 [Vibrio splendidus LGP32]
MLSSDFTRRPIDEKKPYGTNPNGLDEFTEIKRQINNINKVTGRVSWKKIQTLSKEILSKNSKDFRCSCYF
TVAATHNEGLKGLVEGLNSILDLCVIYWFTAYPEVTKSNARIGAIDWMVEHTDKRIKSIKTSSDDILLIE
TCHRLCLRIEEELRLHYGIKAPSLGGIRRTLKHWVDEHKENEAKLFEAENTKKLRVSEEHKKAIPVVQPS
TIKIDVSNNKPKNAAEVDGKSTSSYLVIYLLVGFLILALSSHFIYKQYQRKELARQIVTSDIPQLNEIVH
SLKYEYASISDDVRPSVVNQLDELMKDWGTDPIKVYEIDTLNQLTIDLTKLYPDSSSVLRLRNEFTNEQQ
KLNADYIKLHRRFSNARTVFANAIRGSESQKTAQAYEYSNSLFPLIGRIEYAEKEKQQKELQKSLQILNV
YLHKIKNLESELKAIKP
 
Nucleotide Sequence: 1314 bp     [Download]
>gi|294510242|ref|NC_011744.2|:1093545-1094858 Vibrio splendidus LGP32 chromosome 2, complete sequence
ATGCTCTCGTCAGATTTTACAAGACGCCCCATTGATGAAAAAAAACCCTACGGAACCAATCCTAACGGGT
TAGATGAATTCACAGAGATAAAGCGCCAAATTAATAACATAAACAAGGTCACAGGCAGAGTTTCTTGGAA
AAAAATTCAGACTTTGTCGAAAGAAATACTGTCCAAAAACAGTAAAGATTTCCGTTGTAGCTGTTATTTT
ACTGTTGCAGCTACGCACAACGAAGGCTTAAAAGGTTTAGTTGAAGGGCTTAACTCTATCTTAGATTTGT
GTGTCATTTATTGGTTCACCGCATATCCAGAGGTGACAAAATCAAATGCAAGGATCGGAGCGATTGATTG
GATGGTCGAACACACAGATAAACGAATTAAGTCCATAAAAACAAGTTCCGACGACATTCTATTGATCGAA
ACATGCCACCGCTTATGTTTGAGAATAGAAGAAGAGCTCAGACTACATTACGGTATAAAAGCACCTTCAC
TGGGGGGAATTCGTCGAACCTTAAAGCACTGGGTTGATGAGCATAAAGAGAACGAAGCAAAACTCTTTGA
AGCAGAAAACACAAAAAAACTCCGCGTTTCGGAAGAACATAAAAAGGCAATACCAGTAGTTCAGCCATCA
ACCATTAAAATCGATGTGTCTAACAATAAACCTAAGAATGCAGCTGAAGTCGATGGAAAATCGACCTCGA
GTTATTTAGTCATCTATCTTCTCGTTGGGTTTCTAATTTTGGCTTTATCCTCTCATTTCATTTATAAACA
ATATCAACGAAAAGAGTTGGCTAGACAAATCGTTACGTCTGATATCCCACAACTGAATGAAATAGTACAT
TCACTAAAGTATGAATATGCTTCGATTTCTGATGATGTAAGACCTAGTGTCGTCAATCAATTAGATGAAT
TAATGAAAGATTGGGGTACCGATCCAATTAAAGTGTACGAGATCGATACTCTAAATCAATTGACTATTGA
TTTAACTAAGCTTTACCCAGACTCATCATCCGTCTTACGTTTACGTAACGAATTCACTAATGAGCAACAA
AAGTTAAACGCAGATTACATAAAACTTCATCGACGCTTCTCAAACGCGAGAACTGTGTTTGCAAATGCAA
TTAGAGGAAGTGAAAGTCAGAAAACAGCACAAGCTTACGAATACAGCAACTCCCTTTTCCCGTTGATTGG
CCGTATTGAATATGCAGAAAAAGAAAAACAACAAAAAGAGCTGCAGAAATCTCTTCAAATACTCAACGTC
TATTTACACAAAATTAAAAACTTGGAGTCTGAGCTTAAAGCTATTAAACCGTAA